• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

anti-AJUBA antibody :: Mouse anti-Human Ajuba Monoclonal Antibody

Scan QR to view Datasheet
Catalog # MBS375105
Unit / Price
Scan QR to view Datasheet
  0.1 mL  /  $415 +1 FREE 8GB USB
Western Blot (WB)
Product Name

Ajuba, Monoclonal Antibody

Full Product Name

Mouse Anti-Ajuba [21G4]

Product Synonym Names
Jub antibody; MGC15563 antibody; Protein ajuba antibody
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
OMIM
609066
3D Structure
ModBase 3D Structure for Q96IF1
Clonality
Monoclonal
Isotype
IgG1
Clone Number
21G4
Host
Mouse
Species Reactivity
Human
Purity/Purification
Protein A Affinity Chromatography
Form/Format
Purified antibody containing PBS + 0.1% sodium azide
Concentration
1mg/ml (lot specific)
Target Antigen
Ajuba
Immunogen
Full length Human Ajuba fused to maltose binding protein. MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSG LGGPRKSGPRGATGGPGDEPLEPAREQGSLDAERNQRGSF EAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSP RSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSN RTSGISMGYDQRHGSPLPAGPCLFGPPLAGAPAGYSPGGV PSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGA LAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDEL TALLRLTVGTGGREAGARGEPSGIEPSGLEEPPGPFVPEA ARARMREPEAREDYFGTCIKCNKGIYGQSNACQALDSLYH TQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAA EKCCVCGHLILEKILQAMGKSYHPGCFRCIVCNKCLDGIP FTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIV RVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLC HGCHMQRLNARQPPANYI
Myeloma/fusion Partners
NS1 myeloma
Other Notes
Small volumes of anti-AJUBA antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Applications Tested/Suitable for anti-AJUBA antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes for anti-AJUBA antibody
Optimal antibody dilution should be determined by titration, however as a guideline try at; WB: 1/100. Predicted molecular weight: 57 kDa

Western Blot (WB) of anti-AJUBA antibody
anti-AJUBA antibody Western Blot (WB) (WB) image
NCBI/Uniprot data below describe general gene information for AJUBA. It may not necessarily be applicable to this product.
NCBI GI #
NCBI GeneID
NCBI Accession #
UniProt Primary Accession #
UniProt Secondary Accession #
UniProt Related Accession #
Molecular Weight
13,795 Da[Similar Products]
NCBI Official Full Name
ajuba
NCBI Official Synonym Full Names
ajuba LIM protein
NCBI Official Symbol
AJUBA  [Similar Products]
NCBI Official Synonym Symbols
NCBI Protein Information
LIM domain-containing protein ajuba; jub, ajuba homolog
UniProt Protein Name
LIM domain-containing protein ajuba
UniProt Gene Name
AJUBA  [Similar Products]
UniProt Synonym Gene Names
UniProt Entry Name
AJUBA_HUMAN
UniProt Comments for AJUBA
JUB: Adapter or scaffold protein which participates in the assembly of numerous protein complexes and is involved in several cellular processes such as cell fate determination, cytoskeletal organization, repression of gene transcription, mitosis, cell-cell adhesion, cell differentiation, proliferation and migration. Contributes to the linking and/or strengthening of epithelia cell- cell junctions in part by linking adhesive receptors to the actin cytoskeleton. May be involved in signal transduction from cell adhesion sites to the nucleus. Plays an important role in regulation of the kinase activity of AURKA for mitotic commitment. Also a component of the IL-1 signaling pathway modulating IL-1- induced NFKB1 activation by influencing the assembly and activity of the PRKCZ-SQSTM1-TRAF6 multiprotein signaling complex. Functions as an HDAC-dependent corepressor for a subset of GFI1 target genes. Acts as a transcriptional corepressor for SNAI1 and SNAI2/SLUG-dependent repression of E-cadherin transcription. Acts as a hypoxic regulator by bridging an association between the prolyl hydroxylases and VHL enabling efficient degradation of HIF1A. Positively regulates microRNA (miRNA)-mediated gene silencing. Negatively regulates the Hippo signaling pathway and antagonizes phosphorylation of YAP1. Interacts with GRB2, PIP5K1B and SLC1A2. Interacts with AURKA; the interaction occurs during mitosis and both proteins are phosphorylated as they form a complex. Interacts with CTNNA1 and with F-actin. Interacts with LATS2; the interaction occurs during mitosis and the complex regulates organization of the spindle apparatus through recruitment of TUBG to the centrosome. Forms a complex with SQSTM1, PRKCZ and TRAF6. Component of the GFI1-AJUBA-HDAC1 repressor complex. Interacts directly (via the LIM domains) with GFI1; the interaction results in the HDAC-dependent corepression of a subset of GFI1 target genes, and is independent of the GFI1 SNAG domain. Interacts with HDAC1, HDAC2 and HDAC3. Interacts with SNAI2/SLUG (via SNAG domain) and SCRT1 (via SNAG domain). Interacts with EIF4E, EIF2C1, EIF2C2, DCP2, DDX6, LATS1, LATS2, SAV1, EGLN2/PHD1 and EGLN3/PHD3. Interacts (via LIM domains) with isoform 1 and isoform 3 of VHL. Interacts (via LIM domains) with SNAI1 (via SNAG domain). Belongs to the zyxin/ajuba family.

Protein type: Cell adhesion; Motility/polarity/chemotaxis; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: transcription factor complex; focal adhesion; lamellipodium; plasma membrane; microtubule organizing center; intercellular junction; cytosol; nucleus

Molecular Function: actin filament binding; protein binding; zinc ion binding; chromatin binding; transcription corepressor activity; alpha-catenin binding

Biological Process: focal adhesion formation; lamellipodium biogenesis; negative regulation of kinase activity; regulation of GTPase activity; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; glycerophospholipid biosynthetic process; negative regulation of transcription from RNA polymerase II promoter; positive regulation of cellular biosynthetic process; miRNA-mediated gene silencing; regulation of cell migration; positive regulation of MAP kinase activity; positive regulation of protein complex assembly; calcium-dependent cell-cell adhesion; response to hypoxia; mitotic cell cycle; G2/M transition of mitotic cell cycle; wound healing, spreading of epidermal cells
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000