• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

anti-amh antibody :: Mouse Anti-Mullerian Hormone Monoclonal Antibody

Scan QR to view Datasheet
Catalog # MBS606224
Unit / Price
  1 mL  /  $905 +1 FREE 8GB USB
anti-amh antibody
Product Name

Anti-Mullerian Hormone (amh), Monoclonal Antibody

Popular Item
Also Known As

Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting Substance, MIS)

Product Synonym Names
Anti -Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting Substance, MIS)
Product Gene Name
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Clonality
Monoclonal
Isotype
IgG1
Clone Number
10B151
Host
Mouse
Species Reactivity
Human, Monkey, Mouse, Sheep
Specificity
Recognizes human Anti-Mullerian Hormone.
Species Crossreactivity: mouse, sheep, squirrel monkey and baboon.
Purity/Purification
Supernatant
Supernatant
Form/Format
Supplied as a liquid, 0.1% sodium azide.
Immunogen
Synthetic peptide corresponding to human Anti-Mullerian Hormone (VPTAYAGKLLISLSEERISAHHVPNMVATEC).
Positive Control Tissue
Ovary
Hybridoma
Sp2/0 myeloma cells with spleen cells from T/O outbred mice.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Other Notes
Small volumes of anti-amh antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-amh antibody
Anti-mullerian hormone (AMH) is originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer.
Applications Tested/Suitable for anti-amh antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes for anti-amh antibody
Suitable for use in Immunohistochemistry and Western Blot.
Dilution: Immunohistochemistry (paraffin): 1:20-1:40 Requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer, pH 6.0 is recommended.
NCBI/Uniprot data below describe general gene information for amh. It may not necessarily be applicable to this product.
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
anti-mullerian hormone
NCBI Official Symbol
NCBI Protein Information
anti-mullerian hormone
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000