• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

anti-SLC15A4 antibody :: Rabbit anti-Human SLC15A4 Polyclonal Antibody

Scan QR to view Datasheet
Catalog # MBS5300967
Unit / Price
  0.05 mg  /  $455 +1 FREE 8GB USB
Western Blot (WB)
Product Name

SLC15A4, Polyclonal Antibody

Also Known As

SLC15A4 antibody

Product Synonym Names
Polyclonal SLC15A4; Anti-SLC15A4; PHT1; SLCA4-15; Solute Carrier Family 15 Member 4; PTR4; FP12591; SLCA4 15; SLC15A4
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Immunogen Sequence Length
577
OMIM
615806
Clonality
Polyclonal
Host
Rabbit
Species Reactivity
Human
Specificity
SLC15A4 antibody was raised against the middle region of SLC15A4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC15A4 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.
Immunogen
SLC15A4 antibody was raised using the middle region of SLC15A4 corresponding to a region with amino acids  GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-SLC15A4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-SLC15A4 antibody
Rabbit polyclonal SLC15A4 antibody raised against the middle region of SLC15A4
Applications Tested/Suitable for anti-SLC15A4 antibody
Western Blot (WB)
Application Notes for anti-SLC15A4 antibody
WB: 1 ug/ml

Western Blot (WB) of anti-SLC15A4 antibody
SLC15A4 antibody (MBS5300967) used at 1 ug/ml to detect target protein.
anti-SLC15A4 antibody Western Blot (WB) (WB) image
NCBI/Uniprot data below describe general gene information for SLC15A4. It may not necessarily be applicable to this product.
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Secondary Accession #
UniProt Related Accession #
Molecular Weight
62 kDa (MW of target protein)
NCBI Official Full Name
solute carrier family 15 member 4
NCBI Official Synonym Full Names
solute carrier family 15 (oligopeptide transporter), member 4
NCBI Official Symbol
SLC15A4  [Similar Products]
NCBI Official Synonym Symbols
PHT1; PTR4; FP12591
  [Similar Products]
NCBI Protein Information
solute carrier family 15 member 4
UniProt Protein Name
Solute carrier family 15 member 4
UniProt Synonym Protein Names
Peptide transporter 4; Peptide/histidine transporter 1; hPHT1
Protein Family
UniProt Gene Name
SLC15A4  [Similar Products]
UniProt Synonym Gene Names
PHT1; PTR4; hPHT1  [Similar Products]
UniProt Entry Name
S15A4_HUMAN
UniProt Comments for SLC15A4
SLC15A4: Proton oligopeptide cotransporter. Transports free histidine and certain di- and tripeptides. Belongs to the PTR2/POT transporter (TC 2.A.17) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Membrane protein, multi-pass; Transporter; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q24.32

Cellular Component: lysosomal membrane; integral to membrane

Molecular Function: L-histidine transmembrane transporter activity; symporter activity

Biological Process: protein transport; ion transport; oligopeptide transport; transmembrane transport
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000