Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource rightarrow Antibody rightarrow amh rightarrow Monoclonal amh  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Menu separator
separator
ELISA Kit ELISA Kit
CLIA Kit CLIA Kit
PCR Kit PCR Kit
Monoclonal Antibody Monoclonal Antibody
Polyclonal Antibody Polyclonal Antibody
Secondary Antibody Secondary Antibody
Antigen Antigen
Biochemical Biochemical
cDNA Clone cDNA Clone
siRNA siRNA
Peptide Peptide
Recombinant/Purified Protein Rec./Purified Protein

Custom ELISA Kit Custom ELISA Kit
Custom Protein Custom Protein
Custom Antibody Custom Antibody
Antibody Matched Pairs Antibody Matched Pairs
Antibody & Corresponding Blocking Peptide Pairs Antibody Peptide Pairs
Phospho-Specific Antibodies Phospho Antibodies
Products by Disease Products by Disease
Products by Pathway Products by Pathway
Products by Tissue Products by Tissue

arrow Advanced Search
arrow Submit Technical Q&A
arrow International Distributors
arrow Contact Us
separator
Our Best Sellers moreseparator
separator
 • Alpha-2A adrenergic receptor (ADRA2A) Recombinant Protein
 • Nitrotyrosine ELISA Kit
 • Angiopoietin 1 (ANG1) ELISA Kit
 • BTrypsin Recombinant Protein
 • Spermiogenesis Antibody (ASAB) ELISA Kit
 • 14-3-3 Zeta (1433Z) ELISA Kit
 • Matrix Metalloproteinase 7 (MMP-7) ELISA Kit
 • ZCCHC4 Antibody
 • Growth Hormone Binding Protein (GHBP) ELISA Kit
 • Treponema pallidum Antibody
 • anti-hepatitis C virus (HCV) antibody ELISA Kit
 • anti-chromosome antibody (anti-chromosome Ab) ELISA Kit
 • B cell growth protein (BCGF) ELISA Kit
 • APC3 (CDC27) Antibody
 downarrow more ...
separator
separator
DatasheetFull DatasheetPrinter Friendly DatasheetPrint This DatasheetAdd to Compare ListHave Questions? Ask UsRequest for a Quotation today

anti-amh antibody :: Mouse Anti-Mullerian Hormone Monoclonal Antibody

Scan QR to view Datasheet Catalog #    MBS606224 anti-amh antibody
Unit / Price
1 mL  /  $905 +1 FREE 8GB USB
 
 Go to:   rightarrow  Product Names   rightarrow Product Info   rightarrow Accession #s   rightarrow Product Desc   rightarrow Diseases/Tissues/Pathways   rightarrow Applications   rightarrow References 
 Product Name   

Anti-Mullerian Hormone (amh), Monoclonal Antibody

★Popular Item★
 Also Known As   

Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting Substance, MIS)

 Product Synonym Names    Anti -Anti-Mullerian Hormone (AMH, Muellerian-inhibiting Factor, Muellerian-inhibiting Substance, MIS)
 Product Gene Name   

anti-amh antibody

[Similar Products]
 Research Use Only    For Research Use Only. Not for use in diagnostic procedures.
Table BarTOPTable Bar
 Clonality    Monoclonal
 Isotype    IgG1
 Clone Number    10B151
 Host    Mouse
 Species Reactivity    Human, Monkey, Mouse, Sheep
Section Bar
 Specificity    Recognizes human Anti-Mullerian Hormone.
Species Crossreactivity: mouse, sheep, squirrel monkey and baboon.
 Purity/Purification    Supernatant
Supernatant
 Form/Format    Supplied as a liquid, 0.1% sodium azide.
Section Bar
 Immunogen    Synthetic peptide corresponding to human Anti-Mullerian Hormone (VPTAYAGKLLISLSEERISAHHVPNMVATEC).
 Positive Control Tissue    Ovary
 Hybridoma    Sp2/0 myeloma cells with spleen cells from T/O outbred mice.
Section Bar
 Preparation and Storage    May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
 Other Notes    Small volumes of anti-amh antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Table BarTOPTable Bar
 

Related Product Information for anti-amh antibody

   Anti-mullerian hormone (AMH) is originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer.
 Product Categories/Family for anti-amh antibody    Antibodies; Abs to Hormones, Steroids
 Applications Tested/Suitable for anti-amh antibody   

Western Blot (WB), Immunohistochemistry (IHC)

 Application Notes for anti-amh antibody    Suitable for use in Immunohistochemistry and Western Blot.
Dilution: Immunohistochemistry (paraffin): 1:20-1:40 Requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer, pH 6.0 is recommended.
Table BarTOPTable Bar
NCBI/Uniprot data below describe general gene information for amh. It may not necessarily be applicable to this product.
 NCBI GI #    157278197
 NCBI GeneID    100049306
 NCBI Accession #    NP_001098198.1 [Other Products]
 NCBI GenBank Nucleotide #    NM_001104728.1 [Other Products]
Table BarTOPTable Bar
 NCBI Official Full Name    anti-mullerian hormone
 NCBI Official Symbol    amh [Similar Products]
 NCBI Protein Information    anti-mullerian hormone
 Protein Family    Muellerian-inhibiting factor
Section Bar
 Precautions    All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
 Disclaimer    While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
Table BarTOPTable Bar
Organs/Tissues associated with anti-amh antibody
 Organ/Tissue Name  Pubmed Publications
 Bone Antibodies  >13 publications with amh and Bone
 Connective Tissue Antibodies  >4 publications with amh and Connective Tissue
 Heart Antibodies  >3 publications with amh and Heart
 Muscle Antibodies  >3 publications with amh and Muscle
 Brain Antibodies  >3 publications with amh and Brain
 Vascular Antibodies  >2 publications with amh and Vascular
 Embryonic Tissue Antibodies  >2 publications with amh and Embryonic Tissue
 Ear Antibodies  >1 publications with amh and Ear
 Kidney Antibodies  >1 publications with amh and Kidney
 Umbilical Cord Antibodies  >1 publications with amh and Umbilical Cord
Table BarTOPTable Bar
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions