Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource rightarrow Antibody rightarrow ACTH rightarrow Polyclonal ACTH  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Menu separator
separator
ELISA Kit ELISA Kit
CLIA Kit CLIA Kit
PCR Kit PCR Kit
Monoclonal Antibody Monoclonal Antibody
Polyclonal Antibody Polyclonal Antibody
Secondary Antibody Secondary Antibody
Antigen Antigen
Biochemical Biochemical
cDNA Clone cDNA Clone
siRNA siRNA
Peptide Peptide
Recombinant/Purified Protein Rec./Purified Protein

Custom ELISA Kit Custom ELISA Kit
Custom Protein Custom Protein
Custom Antibody Custom Antibody
Antibody Matched Pairs Antibody Matched Pairs
Antibody & Corresponding Blocking Peptide Pairs Antibody Peptide Pairs
Phospho-Specific Antibodies Phospho Antibodies
Products by Disease Products by Disease
Products by Pathway Products by Pathway
Products by Tissue Products by Tissue

arrow Advanced Search
arrow Submit Technical Q&A
arrow International Distributors
arrow Contact Us
separator
Our Best Sellers moreseparator
separator
 • Integrin, alpha9 (ITGA9) Antibody
 • Sulfotransferase 1A1 (Sult1a1) Recombinant Protein
 • Brn3A (Pou4f1) Antibody
 • Adenomatous Polyposis Coli (APC) Antibody
 • AVPV1a Antibody
 • BARD1 Antibody
 • IL-36Ra (IL36B) Recombinant Protein
 • Nerve Growth Factor beta (NGF-b) Recombinant Recombinant Protein
 • BACE (CT) Antibody
 • P21; CDKN1A Antibody
 • 3-phosphoinositide dependent protein kinase-1 (PDPK1) ELISA Kit
 • Glucagon (GC) ELISA Kit
 • slingshot homolog 1 (Drosophila) (SSH1) ELISA Kit
 • Glucose Regulated Protein 94 (HSP90B1) Antibody
 downarrow more ...
separator
separator
DatasheetFull DatasheetPrinter Friendly DatasheetPrint This DatasheetAdd to Compare ListHave Questions? Ask UsRequest for a Quotation today

anti-ACTH antibody :: Rabbit ACTH Polyclonal Antibody

Scan QR to view Datasheet Catalog #    MBS540945 anti-ACTH antibody
Unit / Price
0.1 mg Biotin  /  $495 +1 FREE 8GB USB
 
 Go to:   rightarrow  Product Names   rightarrow Product Info   rightarrow Accession #s   rightarrow Product Desc   rightarrow Diseases/Tissues/Pathways   rightarrow Applications   rightarrow References 
 Product Name   

ACTH, Polyclonal Antibody

 Also Known As   

ACTH Antibody BIOTIN-Conjugated

 Product Synonym Names    Alpha Melanocyte Stimulating Hormone; Beta Endorphin; Beta Lipotropin; Beta Melanocyte Stimulating Hormone; Beta-endorphin; CLIP; Corticotropin Like Intermediary Peptide; Met-enkephalin; MSH; NPP; Opiomelanocortin prepropeptide; POC; POMC; Tetracosactide antibody
 Product Gene Name   

anti-ACTH antibody

[Similar Products]
 Antibody/Peptide Pairs    ACTH peptide (MBS542334) is used for blocking the activity of ACTH antibody (MBS540945)
 Matching Pairs    Antibody: ACTH (MBS540945)
Positive Control: ACTH (MBS542504)
 Research Use Only    For Research Use Only. Not for use in diagnostic procedures.
Table BarTOPTable Bar
 Clonality    Polyclonal
 Host    Rabbit
 Species Reactivity    Human, Mouse, Rat
Predicted: Chicken, Chimpanzee, Cow, Dog, Goat, Guinea pig, Macaque Monkey, Orangutan, Sheep
Section Bar
 Form/Format    BIOTIN-Conjugated
 Concentration    0.63-0.68 ug/ul in antibody stabilization buffer (lot specific)
Section Bar
 Immunogen    Synthetic peptide corresponding to ACTH aa 138-176.
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
 Expression    ACTH and MSH are produced by the pituitary gland
 Molecular Function    GPCR; Hormone activity
 Structure    Belongs to POMC family
 Subcellular Location    Secreted
Section Bar
 Preparation and Storage    -20 degree C for long term storage
 Other Notes    Small volumes of anti-ACTH antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Table BarTOPTable Bar
 

Product Description specifically for anti-ACTH antibody

   BIOTIN-Conjugated Adrenocorticotropin Hormone Antibody
Stimulates adrenal glands and release cortisol.
 Applications Tested/Suitable for anti-ACTH antibody   

ELISA (EIA), Immunohistochemistry (IHC) Formalin/Paraffin, Immunoprecipitation (IP), Western Blot (WB)

 Application Notes for anti-ACTH antibody    Confocal Microscopy||1:250
Immunocytochemistry: 1:250
Immunofluorescence: 1:200
Immunohistochemistry: 1:250
Immunoprecipitation: 1:200
Western Blot: 1:1,000
Table BarTOPTable Bar
NCBI/Uniprot data below describe general gene information for ACTH. It may not necessarily be applicable to this product.
 NCBI GI #    60829907
 NCBI Accession #    AAX36901 [Other Products]
Table BarTOPTable Bar
 NCBI Official Full Name    proopiomelanocortin, partial
Section Bar
 Precautions    All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
 Disclaimer    While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
Table BarTOPTable Bar
Products related to ACTH Antibody BIOTIN-Conjugated
 Catalog #  Product Name  Catalog #  Product Name
 MBS2020000  Adrenocorticotropic Hormone (ACTH) ELISA Kit  MBS2025565  Adrenocorticotropic Hormone (ACTH) ELISA Kit
 MBS8246010  ACTH (3-24) (Human)  MBS2023711  Adrenocorticotropic Hormone Receptor (ACTHR) ELISA Kit
 MBS352020  ACTH [1-39] (Human) IgG fraction  MBS261693  Guinea pig Adrenocorticotropic Hormone (ACTH) ELISA Kit
 MBS242567  Rabbit Polyclonal to Human ACTH  MBS406441  Anti ACTH (Rat) Serum (50 ul)
 MBS530162  ACTH antibody  MBS633706  ACTH (1-39) ((human) (POMC, Adrenocorticotropin, beta Lipotropin, alpha (beta) Melanocyte Stimulatin...
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions