View our list of available Coronavirus (COVID-19, SARS-CoV-2, 2019-nCOV) antibodies, recombinant proteins, ELISA Kits... Options Full Datasheet Printer Friendly Datasheet Prepare for Printing Full Datasheet Printer Friendly Datasheet Prepare for Printing Have Questions? Ask Us! Request A Quote Today! Add To Compare List Rabbit N Polyclonal Antibody Catalog # MBS839244 Unit / Price Please Inquire Product Name Product Info Accession #s Product Desc Diseases/Tissues/Pathways Applications References Product Name N, Polyclonal Antibody Full Product Name N antibody Product Synonym Names Polyclonal N; Anti-N; Alpha Acetyltransferase 38; Natc Auxiliary Subunit; YJR022W; LSM8 Research Use Only For Research Use Only. Not for use in diagnostic procedures. TOP Clonality Polyclonal Host Rabbit Purity/Purification Affinity purified Form/Format Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LSM8 antibody in PBS Concentration 1 mg/ml (lot specific) Biological Significance This gene encodes a member of the like-Sm family of proteins. The encoded protein consists of a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. This protein partners with six paralogs to form a heteroheptameric ring which transiently binds U6 small nuclear RNAs and is involved in the general maturation of RNA in the nucleus. Cross-Reactivity Human Immunogen N antibody was raised using a synthetic peptide corresponding to a region with amino acids MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ Preparation and Storage Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles. Other Notes Small volumes of anti-N antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply. TOP Related Product Information for anti-N antibody Rabbit polyclonal N antibody Product Categories/Family for anti-N antibody DNA & RNA; Purified Polyclonal Antibodies Applications Tested/Suitable for anti-N antibody Western Blot (WB) Application Notes for anti-N antibody WB: 1 ug/ml Western Blot (WB) of anti-N antibody N antibody (MBS839244) used at 1 ug/ml to detect target protein. TOP Molecular Weight 10 kDa (MW of target protein)[Similar Products] TOP Protein Family NIP3 Precautions All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines. Disclaimer While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information. TOP