Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
Fax 1.858.633.0166    Email 
menu1 Home Products Ordering Company Help menu7
   MyBioSource rightarrow Antibody rightarrow SLC15A4 rightarrow Polyclonal SLC15A4  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Menu separator
Monoclonal Antibody Monoclonal Antibody
Polyclonal Antibody Polyclonal Antibody
Secondary Antibody Secondary Antibody
Antigen Antigen
Biochemical Biochemical
cDNA Clone cDNA Clone
Peptide Peptide
Recombinant/Purified Protein Rec./Purified Protein

Custom ELISA Kit Custom ELISA Kit
Custom Protein Custom Protein
Custom Antibody Custom Antibody
Antibody Matched Pairs Antibody Matched Pairs
Antibody & Corresponding Blocking Peptide Pairs Antibody Peptide Pairs
Phospho-Specific Antibodies Phospho Antibodies
Products by Disease Products by Disease
Products by Pathway Products by Pathway
Products by Tissue Products by Tissue

arrow Advanced Search
arrow Submit Technical Q&A
arrow International Distributors
arrow Contact Us
Our Best Sellers moreseparator
 • Alkaline Phosphatase (ALP) ELISA Kit
 • ITGB1 Antibody
 • Sodium-Glucose Cotransporter 2 (SGLT2) ELISA Kit
 • WHIP - WRNIP1 Peptide
 • ICOSLG - ICOSL - ICOS Ligand Antibody
 • GLU2B Antibody
 • Transforming Growth Factor-Beta 1 (TGF b 1 ) Recombinant Protein
 • AKT (AKT1) Antibody
 • Vascular Cell Adhesion Molecule-1 (VCAM-1) Western Blot Control
 • beta2M Recombinant Protein
 • IRAK4 Antibody
 • AR Antibody
 • cPLA2 Antibody
 • Mucin 6 (MUC6) Antibody
 downarrow more ...
DatasheetFull DatasheetPrinter Friendly DatasheetPrint This DatasheetAdd to Compare ListHave Questions? Ask UsRequest for a Quotation today

anti-SLC15A4 antibody :: Rabbit anti-Human SLC15A4 Polyclonal Antibody

Scan QR to view Datasheet Catalog #    MBS5300967
Western Blot (WB)
Unit / Price
0.05 mg  /  $455 +1 FREE 8GB USB
 Go to:   rightarrow  Product Names   rightarrow Product Info   rightarrow Accession #s   rightarrow Product Desc   rightarrow Diseases/Tissues/Pathways   rightarrow Applications   rightarrow References 
 Product Name   

SLC15A4, Polyclonal Antibody

 Also Known As   

SLC15A4 antibody

 Product Synonym Names    Polyclonal SLC15A4; Anti-SLC15A4; PHT1; SLCA4-15; Solute Carrier Family 15 Member 4; PTR4; FP12591; SLCA4 15; SLC15A4
 Product Gene Name   

anti-SLC15A4 antibody

[Similar Products]
 Research Use Only    For Research Use Only. Not for use in diagnostic procedures.
Table BarTOPTable Bar
 OMIM    615806
Section Bar
 Clonality    Polyclonal
 Host    Rabbit
 Species Reactivity    Human
Section Bar
 Specificity    SLC15A4 antibody was raised against the middle region of SLC15A4
 Purity/Purification    Affinity purified
 Form/Format    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC15A4 antibody in PBS
 Concentration    1 mg/ml (lot specific)
Section Bar
 Biological Significance    SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.
 Immunogen    SLC15A4 antibody was raised using the middle region of SLC15A4 corresponding to a region with amino acids  GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH
Section Bar
 Preparation and Storage    Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
 Other Notes    Small volumes of anti-SLC15A4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Table BarTOPTable Bar

Related Product Information for anti-SLC15A4 antibody

   Rabbit polyclonal SLC15A4 antibody raised against the middle region of SLC15A4
 Product Categories/Family for anti-SLC15A4 antibody    Cell Biology; Purified Polyclonal Antibodies
 Applications Tested/Suitable for anti-SLC15A4 antibody   

Western Blot (WB)

 Application Notes for anti-SLC15A4 antibody    WB: 1 ug/ml
Section Bar
 Western Blot (WB) of anti-SLC15A4 antibody    SLC15A4 antibody (MBS5300967) used at 1 ug/ml to detect target protein.
anti-SLC15A4 antibody Western Blot (WB) (WB) image
Table BarTOPTable Bar
NCBI/Uniprot data below describe general gene information for SLC15A4. It may not necessarily be applicable to this product.
 NCBI GI #    21717816
 NCBI GeneID    121260
 NCBI Accession #    NP_663623.1 [Other Products]
 NCBI GenBank Nucleotide #    NM_145648.3 [Other Products]
Section Bar
 UniProt Secondary Accession #    Q71M34; Q7Z5F8; Q8TAH0; A6H8Y9; B3KTK1 [Other Products]
 UniProt Related Accession #    Q8N697 [Other Products]
 Molecular Weight    62 kDa (MW of target protein)
Table BarTOPTable Bar
 NCBI Official Full Name    solute carrier family 15 member 4
 NCBI Official Synonym Full Names    solute carrier family 15 (oligopeptide transporter), member 4
 NCBI Official Symbol    SLC15A4 [Similar Products]
 NCBI Official Synonym Symbols   
PHT1; PTR4; FP12591
[Similar Products]
 NCBI Protein Information    solute carrier family 15 member 4
 UniProt Protein Name    Solute carrier family 15 member 4
 UniProt Synonym Protein Names   
Peptide transporter 4; Peptide/histidine transporter 1; hPHT1
 Protein Family    Solute carrier family
 UniProt Gene Name    SLC15A4 [Similar Products]
 UniProt Synonym Gene Names    PHT1; PTR4; hPHT1 [Similar Products]
 UniProt Entry Name    S15A4_HUMAN
Section Bar
 UniProt Comments for SLC15A4    SLC15A4: Proton oligopeptide cotransporter. Transports free histidine and certain di- and tripeptides. Belongs to the PTR2/POT transporter (TC 2.A.17) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Membrane protein, multi-pass; Transporter; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q24.32

Cellular Component: lysosomal membrane; integral to membrane

Molecular Function: L-histidine transmembrane transporter activity; symporter activity

Biological Process: protein transport; ion transport; oligopeptide transport; transmembrane transport
Table BarTOPTable Bar
 Research Articles on SLC15A4    1. Mutations in SLC15A4,a peptide transporter in NFkB signaling pathway, have been implicated in Systemic Lupus Erythematosus development in susceptible individuals.
Table BarTOPTable Bar
 Precautions    All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
 Disclaimer    While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
Table BarTOPTable Bar
Products associated with anti-SLC15A4 antibodyPathways associated with anti-SLC15A4 antibody
 Reference Product  PubMed Publications
 SLC15A3 antibody  >7 publications with SLC15A4 and SLC15A3
 RASGRP3 antibody  >3 publications with SLC15A4 and RASGRP3
 NOD2 antibody  >2 publications with SLC15A4 and NOD2
 Products by Pathway  Pathway Diagram
 Proton/oligonucleotide Cotransporters Pathway antibodies  Proton/oligonucleotide Cotransporters Pathway Diagram
 SLC-mediated Transmembrane Transport Pathway antibodies  SLC-mediated Transmembrane Transport Pathway Diagram
 Transmembrane Transport Of Small Molecules Pathway antibodies  Transmembrane Transport Of Small Molecules Pathway Diagram
 Transport Of Inorganic Cations/anions And Amino Acids/oligopeptides Pathway antibodies  Transport Of Inorganic Cations/anions And Amino Acids/oligopeptides Pathway Diagram
Diseases associated with anti-SLC15A4 antibodyOrgans/Tissues associated with anti-SLC15A4 antibody
 Disease Name  Pubmed Publications
 Lupus Erythematosus, Systemic Antibodies  >8 publications with SLC15A4 and Lupus Erythematosus, Systemic
 Inflammation Antibodies  >4 publications with SLC15A4 and Inflammation
 Nervous System Diseases Antibodies  >3 publications with SLC15A4 and Nervous System Diseases
 Prostatic Neoplasms Antibodies  >2 publications with SLC15A4 and Prostatic Neoplasms
 Nephritis Antibodies  >1 publications with SLC15A4 and Nephritis
 Diabetes Mellitus Antibodies  >1 publications with SLC15A4 and Diabetes Mellitus
 Memory Disorders Antibodies  >1 publications with SLC15A4 and Memory Disorders
 Kidney Diseases Antibodies  >1 publications with SLC15A4 and Kidney Diseases
 Hyperplasia Antibodies  >1 publications with SLC15A4 and Hyperplasia
 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >8 publications with SLC15A4 and Brain
 Blood Antibodies  >4 publications with SLC15A4 and Blood
 Intestine Antibodies  >3 publications with SLC15A4 and Intestine
 Kidney Antibodies  >3 publications with SLC15A4 and Kidney
 Mammary Gland Antibodies  >2 publications with SLC15A4 and Mammary Gland
 Heart Antibodies  >2 publications with SLC15A4 and Heart
 Muscle Antibodies  >2 publications with SLC15A4 and Muscle
 Lung Antibodies  >2 publications with SLC15A4 and Lung
 Prostate Antibodies  >2 publications with SLC15A4 and Prostate
 Thyroid Antibodies  >1 publications with SLC15A4 and Thyroid
Table BarTOPTable Bar
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions