View our list of available Coronavirus (COVID-19, SARS-CoV-2, 2019-nCOV) antibodies, recombinant proteins, ELISA Kits... Options Full Datasheet Printer Friendly Datasheet Prepare for Printing Full Datasheet Printer Friendly Datasheet Prepare for Printing Have Questions? Ask Us! Request A Quote Today! Add To Compare List anti-ZADH1 antibody :: Rabbit ZADH1 Polyclonal Antibody Catalog # MBS5302717 Unit / Price 0.1 mL / $760 +1 FREE 8GB USB 5x0.1 mL / $3,225 +4 FREE 8GB USB Product Name Product Info Accession #s Product Desc Diseases/Tissues/Pathways Applications References Product Name ZADH1, Polyclonal Antibody Full Product Name ZADH1 antibody Product Synonym Names Polyclonal ZADH1; Anti-ZADH1; ZADH 1; FLJ39091; ZADH-1; DKFZp686P10120; PGR-2; Zinc Binding Alcohol Dehydrogenase Domain Containing 1; ZADH1; PGR2 Product Gene Name anti-ZADH1 antibody[Similar Products] Research Use Only For Research Use Only. Not for use in diagnostic procedures. TOP Clonality Polyclonal Host Rabbit Species Reactivity Human, Mouse, Rat Specificity ZADH1 antibody was raised against the middle region of Zadh1 Purity/Purification Affinity purified Form/Format Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZADH1 antibody in PBS Concentration 1 mg/ml (lot specific) Biological Significance ZADH1 is an enzyme involved in the metabolism of prostaglandins. ZADH1 catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. ZADH1 may also be involved in regulating activation of the peroxisome proliferator-activated receptor. Cross-Reactivity Human,Mouse,Rat Immunogen ZADH1 antibody was raised using the middle region of Zadh1 corresponding to a region with amino acids ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT Preparation and Storage Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles. Other Notes Small volumes of anti-ZADH1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply. TOP Related Product Information for anti-ZADH1 antibody Rabbit polyclonal ZADH1 antibody raised against the middle region of Zadh1 Product Categories/Family for anti-ZADH1 antibody Proteases; Inhibitors; & Enzymes; Purified Polyclonal Antibodies Applications Tested/Suitable for anti-ZADH1 antibody Western Blot (WB) Application Notes for anti-ZADH1 antibody WB: 1 ug/ml TOP Molecular Weight 38 kDa (MW of target protein) TOP Precautions All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines. Disclaimer While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information. TOP