Antibody Protein ELISA Kit from MyBioSource header Telephone 1.858.633.0165          
1.855.MyBioSource
Fax 1.858.633.0166    Email sales@mybiosource.com 
tel/fax
menu1 Home Products Ordering Company Help menu7
bottom
   MyBioSource rightarrow Protein rightarrow RNASE3  rightarrow LOG IN  rightarrow MY ACCOUNT  rightarrow CART CONTENTS  rightarrow CHECKOUT 
horiz bar
MyBioSource Menu separator
separator
ELISA Kit ELISA Kit
CLIA Kit CLIA Kit
PCR Kit PCR Kit
Monoclonal Antibody Monoclonal Antibody
Polyclonal Antibody Polyclonal Antibody
Secondary Antibody Secondary Antibody
Antigen Antigen
Biochemical Biochemical
cDNA Clone cDNA Clone
siRNA siRNA
Peptide Peptide
Recombinant/Purified Protein Rec./Purified Protein

Custom ELISA Kit Custom ELISA Kit
Custom Protein Custom Protein
Custom Antibody Custom Antibody
Antibody Matched Pairs Antibody Matched Pairs
Antibody & Corresponding Blocking Peptide Pairs Antibody Peptide Pairs
Phospho-Specific Antibodies Phospho Antibodies
Products by Disease Products by Disease
Products by Pathway Products by Pathway
Products by Tissue Products by Tissue

arrow Advanced Search
arrow Submit Technical Q&A
arrow International Distributors
arrow Contact Us
separator
Our Best Sellers moreseparator
separator
 • Growth Differentiation Factor 9 (GDF9) ELISA Kit
 • 14-3-3 alpha-beta Antibody
 • ApoA5 ELISA Kit
 • STAT6 Antibody
 • CD133 Antibody
 • Polyvalent Dengue Antigen Recombinant Protein
 • AKT1 Antibody
 • VlsE1 Recombinant Protein
 • PDE6C Antibody
 • Amyloid Beta Precursor Like Protein 2 (APLP2) ELISA Kit
 • interleukin 22 (IL22) Recombinant Protein
 • arylsulfatase A (ASA) ELISA Kit
 • transmembrane protein 165 (TMEM165) Antibody
 • pIkappaBalpha ELISA Kit
 downarrow more ...
separator
separator
DatasheetFull DatasheetPrinter Friendly DatasheetPrint This DatasheetAdd to Compare ListHave Questions? Ask UsRequest for a Quotation today

RNASE3 protein :: Eosinophil Cationic Protein

Scan QR to view Datasheet Catalog #    MBS173120 RNASE3 protein
Unit / Price
  DISCONTINUED
You will be redirected to our replacement product
 Go to:   rightarrow  Product Names   rightarrow Product Info   rightarrow Accession #s   rightarrow Product Desc   rightarrow Diseases/Tissues/Pathways   rightarrow Applications   rightarrow References 
 Product Name   

Eosinophil Cationic (RNASE3), Protein

★Popular Item★
 Also Known As   

Eosinophil Cationic Protein (ECP), Human

 Product Synonym Names    ECP; Ribonuclease 3; RNase 3; Eosinophil Cationic Protein (ECP), Native Human - >80% (SDS-PAGE)
 Product Gene Name   

RNASE3 protein

[Similar Products]
 Product Synonym Gene Name    ECP; RNS3 [Similar Products]
 Research Use Only    For Research Use Only. Not for use in diagnostic procedures.
Table BarTOPTable Bar
 MBS173120 COA    COA PDF
 OMIM    131398
 3D Structure    ModBase 3D Structure for P12724
Section Bar
Section Bar
 Purity/Purification    > 80% (SDS-PAGE)
 Form/Format    Solution in 50mM ammonium acetate, 200mM Sodium chloride, pH 4.7, 0.2 micron filtered- may contain trace amounts of cetrimonium bromide (cationic surfacant)
 Concentration    Protein Concentration: 0.23 mg protein/mL (BCA) (lot specific)
Section Bar
 Source    Human Eosinophils
 Protein    0.23mg protein/mL (BCA)
 Appearance    Clear, colorless.
 Recertification    8-19-2018
Section Bar
 Preparation and Storage    At -20 degree C
 Other Notes    Small volumes of RNASE3 protein vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Table BarTOPTable Bar
 

Product Description specifically for RNASE3 protein

   MyBioSource is the leading supplier of human Eosinophil Cationic Protein (ECP) for research and diagnostic manufacturing purposes.

Custom preparations, technical support, bulk quantities and aliquoting available.

Sequence: RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Human Eosinophil degranulation in airway tissues is thought to make significant contributions to the pathogenesis of asthma, nasal polyposis, allergic rhinitis, and eosinophilic pneumonia.

It also alters pulmonary surfactant structure and function in asthma and the proteins are critical in the pathogenesis of tropical pulmonary eosinophilia (TPE).

Human Eosinophils are also associated with other diseases of the respiratory tract. Respiratory syncytial virus (RSV) is an important respiratory pathogens worldwide. Infection is often implicated in exacerbation of asthma in children.
 Product Categories/Family for RNASE3 protein    Proteins; Antigens; Enzymes; Standards/controls; Native Proteins; Eosinophil Cationic Protein (ecp)
NCBI/Uniprot data below describe general gene information for RNASE3. It may not necessarily be applicable to this product.
 NCBI GI #    45243507
 NCBI GeneID    6037
 NCBI Accession #    NP_002926.2 [Other Products]
 NCBI GenBank Nucleotide #    NM_002935.2 [Other Products]
Section Bar
 UniProt Primary Accession #    P12724 [Other Products]
 UniProt Secondary Accession #    Q4VBC1; Q8WTP7; Q8WZ62; Q9GZN9 [Other Products]
 UniProt Related Accession #    P12724 [Other Products]
 Molecular Weight    18-22kDa
Table BarTOPTable Bar
 NCBI Official Full Name    eosinophil cationic protein
 NCBI Official Synonym Full Names    ribonuclease, RNase A family, 3
 NCBI Official Symbol    RNASE3 [Similar Products]
 NCBI Official Synonym Symbols   
ECP; RNS3
[Similar Products]
 NCBI Protein Information    eosinophil cationic protein; RNase 3; ribonuclease 3; cytotoxic ribonuclease
 UniProt Protein Name    Eosinophil cationic protein
 UniProt Synonym Protein Names   
Ribonuclease 3; RNase 3
 Protein Family    Eosinophil cationic protein
 UniProt Gene Name    RNASE3 [Similar Products]
 UniProt Synonym Gene Names    ECP; RNS3; ECP; RNase 3 [Similar Products]
 UniProt Entry Name    ECP_HUMAN
Section Bar
 NCBI Summary for RNASE3    The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein exhibits antimicrobial activity against pathogenic bacteria [provided by RefSeq, Oct 2014]
Section Bar
 UniProt Comments for RNASE3    RNASE3: Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. Promotes E.coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content. Belongs to the pancreatic ribonuclease family.

Protein type: EC 3.1.27.-; Secreted, signal peptide; Secreted; Ribonuclease

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: extracellular space; extracellular region

Molecular Function: nucleic acid binding; endonuclease activity; ribonuclease activity

Biological Process: defense response to Gram-positive bacterium; innate immune response in mucosa; RNA catabolic process; antibacterial humoral response
Table BarTOPTable Bar
 Research Articles on RNASE3    1. eosinophil cationic protein levels can be used to diagnosis atopic dermatitis but cannot distinguish between intrinsic and extrinsic disease.
Table BarTOPTable Bar
 Precautions    All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
 Disclaimer    While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
Table BarTOPTable Bar
Products associated with RNASE3 proteinDiseases associated with RNASE3 protein
 Reference Product  PubMed Publications
 RNASE2 protein  >5 publications with RNASE3 and RNASE2
 MPO protein  >5 publications with RNASE3 and MPO
 EPX protein  >4 publications with RNASE3 and EPX
 IL5 protein  >1 publications with RNASE3 and IL5
 Disease Name  Pubmed Publications
 Hypersensitivity Antibodies  >74 publications with RNASE3 and Hypersensitivity
 Respiratory Tract Diseases Antibodies  >65 publications with RNASE3 and Respiratory Tract Diseases
 Respiratory Hypersensitivity Antibodies  >58 publications with RNASE3 and Respiratory Hypersensitivity
 Asthma Antibodies  >56 publications with RNASE3 and Asthma
 Lung Diseases Antibodies  >49 publications with RNASE3 and Lung Diseases
 Lung Diseases, Obstructive Antibodies  >47 publications with RNASE3 and Lung Diseases, Obstructive
 Inflammation Antibodies  >43 publications with RNASE3 and Inflammation
 Rhinitis Antibodies  >21 publications with RNASE3 and Rhinitis
 Eosinophilia Antibodies  >18 publications with RNASE3 and Eosinophilia
 Rhinitis, Allergic, Seasonal Antibodies  >13 publications with RNASE3 and Rhinitis, Allergic, Seasonal
Organs/Tissues associated with RNASE3 protein
 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >87 publications with RNASE3 and Blood
 Eye Antibodies  >2 publications with RNASE3 and Eye
Table BarTOPTable Bar
horiz bar
 SSL   Follow us on Facebook Follow us onTwitter Follow us on Google Plus Connect us on LinkedIn Subscribe to our RSS Feed for latest products and special promotions