Rabbit Anti-CXCR4 Polyclonal Antibody – Cat# MBS1750310

Figure 1. Western blot analysis of CXCR4 using anti-CXCR4 antibody (MBS1750310).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: HELA whole Cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CXCR4 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CXCR4 at approximately 40KD. The expected band size for CXCR4 is at 40KD.

CXCR4 Antibody – Rabbit Polyclonal

Name: CXCR4 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS1750310
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750310

Description: CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CXCR4, Polyclonal Antibody

Full Product Name

Anti-CXCR4 Picoband Antibody

Product Gene Name

anti-CXCR4 antibody

Product Synonym Names

C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; FB22; Fusin; HM89; LCR1; Leukocyte-derived seven transmembrane domain receptor; LESTR; Lipopolysaccharide-associated protein 3; LAP-3; LPS-associated protein 3; NPYRL; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD184; CXCR4

Clonality

Polyclonal

Host

Rabbit

Species Reactivity

Human
No cross reactivity with other proteins.

Form/Format

Lyophilized

Purity/Purification

Immunogen affinity purified

Concentration

Add 0.2ml of distilled water will yield a concentration of 500ug/ml. (lot specific)

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

39746 MW

OMIM

L01639 mRNA

3D Structure

ModBase 3D Structure for P61073

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Subcellular Localization

Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome. In unstimulated cells, diffuse pattern on plasma membrane. On agonist stimulation, colocalizes with ITCH at the plasma membrane where it becomes ubiquitinated. In the presence of antigen, distributes to the immunological synapse forming at the T-cell-APC contact area, where it localizes at the peripheral and distal supramolecular activation cluster (SMAC).

Tissue Specificity

Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astrocytes), brain microvascular, coronary artery and umbilical cord endothelial cells. Isoform 1 is predominant in all tissues tested.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Product Categories/Family for anti-CXCR4 antibody

Immunology; Innate Immunity; Chemokines; alpha chemokine rec. (cxcr); Microbiology; Interspecies Interaction; Host Virus Interaction; Neuroscience; Neurology Process; Growth and Development; Axonal Guidance Proteins; Stem Cells; Neural Stem Cells; Surface

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-CXCR4 antibody

Western Blot (WB)

Application Notes for anti-CXCR4 antibody

WB: 0.1-0.5mug/ml

Other Notes

Small volumes of anti-CXCR4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CXCR4 purchase

MBS1750310 is an antibody targeting CXCR4. Also known as Anti-CXCR4 Picoband Antibody. Reactive in Human
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for CXCR4. It may not necessarily be applicable to this product.

NCBI GI #

56790927

NCBI GeneID

7852

NCBI Accession #

NP_001008540.1

UniProt Primary Accession #

P61073

UniProt Secondary Accession #

O60835; P30991; P56438; Q53S69; Q9BXA0; Q9UKN2; B2R5N0

UniProt Related Accession #

P61073

GenBank Nucleotide #

NM_001008540.2

NCBI Official Full Name

C-X-C chemokine receptor type 4 isoform a

NCBI Official Synonym Full Names

C-X-C motif chemokine receptor 4

NCBI Official Symbol

CXCR4

NCBI Official Synonym Symbols

FB22; HM89; LAP3; LCR1; NPYR; WHIM; CD184; LAP-3; LESTR; NPY3R; NPYRL; WHIMS; HSY3RR; NPYY3R; D2S201E

UniProt Protein Name

C-X-C chemokine receptor type 4

UniProt Synonym Protein Names

FB22; Fusin; HM89; LCR1; Leukocyte-derived seven transmembrane domain receptor; LESTR; Lipopolysaccharide-associated protein 3; LAP-3; LPS-associated protein 3; NPYRL; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD_antigen: CD184

Protein Family

C-X-C chemokine receptor

UniProt Gene Name

CXCR4

UniProt Synonym Gene Names

CXC-R4; CXCR-4; LESTR; LAP-3; LPS-associated protein 3; SDF-1 receptor

NCBI Protein Information

C-X-C chemokine receptor type 4

NCBI Summary for CXCR4

This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

UniProt Comments for CXCR4

Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival.

Research Articles on CXCR4

1. Results show that CXCR4 is highly expressed in the primary site of non-small cell lung neoplasm (NSCLC) and is associated with poor prognosis which suggest that CXCR4 may play a role in tumor progression of NSCLC.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CXCR4 antibody

Reference Product	PubMed Publications
CXCL12 antibody	>2803 publications with CXCR4 and CXCL12
CCR5 antibody	>2356 publications with CXCR4 and CCR5
CD4 antibody	>1971 publications with CXCR4 and CD4
PTPRC antibody	>114 publications with CXCR4 and PTPRC
STAT3 antibody	>49 publications with CXCR4 and STAT3
JAK2 antibody	>20 publications with CXCR4 and JAK2
STAT1 antibody	>13 publications with CXCR4 and STAT1
PTK2 antibody	>12 publications with CXCR4 and PTK2
DPP4 antibody	>11 publications with CXCR4 and DPP4
SOCS3 antibody	>10 publications with CXCR4 and SOCS3

Pathways associated with anti-CXCR4 antibody

Products by Pathway	Pathway Diagram
Axon Guidance Pathway antibodies	Axon Guidance Pathway Diagram
Axon Guidance Pathway antibodies	Axon Guidance Pathway Diagram
Binding And Entry Of HIV Virion Pathway antibodies	Binding And Entry Of HIV Virion Pathway Diagram
CXCR4-mediated Signaling Events Pathway antibodies	CXCR4-mediated Signaling Events Pathway Diagram
Cardiac Progenitor Differentiation Pathway antibodies	Cardiac Progenitor Differentiation Pathway Diagram
Chemokine Receptors Bind Chemokines Pathway antibodies	Chemokine Receptors Bind Chemokines Pathway Diagram
Chemokine Signaling Pathway antibodies	Chemokine Signaling Pathway Diagram
Chemokine Signaling Pathway antibodies	Chemokine Signaling Pathway Diagram
Class A/1 (Rhodopsin-like Receptors) Pathway antibodies	Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
Cytokine-cytokine Receptor Interaction Pathway antibodies	Cytokine-cytokine Receptor Interaction Pathway Diagram

Diseases associated with anti-CXCR4 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>1771 publications with CXCR4 and Neoplasms
Inflammation Antibodies	>530 publications with CXCR4 and Inflammation
Neoplasm Metastasis Antibodies	>502 publications with CXCR4 and Neoplasm Metastasis
Cardiovascular Diseases Antibodies	>414 publications with CXCR4 and Cardiovascular Diseases
Nervous System Diseases Antibodies	>374 publications with CXCR4 and Nervous System Diseases
Breast Neoplasms Antibodies	>344 publications with CXCR4 and Breast Neoplasms
Necrosis Antibodies	>242 publications with CXCR4 and Necrosis
Lung Neoplasms Antibodies	>187 publications with CXCR4 and Lung Neoplasms
Ischemia Antibodies	>186 publications with CXCR4 and Ischemia
Neoplasms, Experimental Antibodies	>184 publications with CXCR4 and Neoplasms, Experimental

Organs/Tissues associated with anti-CXCR4 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>3300 publications with CXCR4 and Blood
Bone Antibodies	>1330 publications with CXCR4 and Bone
Bone Marrow Antibodies	>1178 publications with CXCR4 and Bone Marrow
Vascular Antibodies	>833 publications with CXCR4 and Vascular
Brain Antibodies	>580 publications with CXCR4 and Brain
Lung Antibodies	>388 publications with CXCR4 and Lung
Lymph Node Antibodies	>359 publications with CXCR4 and Lymph Node
Lymph Antibodies	>351 publications with CXCR4 and Lymph
Liver Antibodies	>345 publications with CXCR4 and Liver
Muscle Antibodies	>267 publications with CXCR4 and Muscle