Rabbit Anti-SRY Polyclonal Antibody – Cat# MBS1750448

Figure 1. Western blot analysis of SRY using anti-SRY antibody (MBS1750448).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SRY antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SRY at approximately 26KD. The expected band size for SRY is at 24KD.

SRY Antibody – Rabbit Polyclonal

Name: SRY Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS1750448
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750448

Description: This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

SRY, Polyclonal Antibody

Full Product Name

Anti-SRY Picoband Antibody

Product Gene Name

anti-SRY antibody

Product Synonym Names

Sex-determining region Y protein; Testis-determining factor; SRY; TDF

Clonality

Polyclonal

Host

Rabbit

Species Reactivity

Human
No cross reactivity with other proteins.

Form/Format

Lyophilized

Purity/Purification

Immunogen affinity purified

Concentration

Add 0.2ml of distilled water will yield a concentration of 500ug/ml. (lot specific)

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

23884 MW

OMIM

X53772 Genomic DNA

3D Structure

ModBase 3D Structure for Q05066

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human SRY (90-130aa ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR).

Subcellular Localization

Nucleus speckle. Cytoplasm. Colocalizes with SOX6 in speckles. Colocalizes with CAML in the nucleus. Colocalizes in the nucleus with ZNF208 isoform KRAB-O and tyrosine hydroxylase (TH) (By similarity).

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Product Categories/Family for anti-SRY antibody

Epigenetics and Nuclear Signaling; histones; hmgs; Epigenetics and Nuclear Signaling; Transcription; Domain Families; hmg box; Transcription Factors; Developmental Biology; Reproduction; Sex Determination; Placental Development

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-SRY antibody

Western Blot (WB)

Application Notes for anti-SRY antibody

WB: 0.1-0.5mug/ml

Other Notes

Small volumes of anti-SRY antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SRY purchase

MBS1750448 is an antibody targeting SRY. Also known as Anti-SRY Picoband Antibody. Reactive in Human
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for SRY. It may not necessarily be applicable to this product.

NCBI GI #

4507225

NCBI GeneID

6736

NCBI Accession #

NP_003131.1

UniProt Primary Accession #

Q05066

UniProt Related Accession #

Q05066

GenBank Nucleotide #

NM_003140.2

NCBI Official Full Name

sex-determining region Y protein

NCBI Official Synonym Full Names

sex determining region Y

NCBI Official Symbol

SRY

NCBI Official Synonym Symbols

TDF; TDY; SRXX1; SRXY1

UniProt Protein Name

Sex-determining region Y protein

UniProt Synonym Protein Names

Testis-determining factor

Protein Family

Sex-determining region Y protein

UniProt Gene Name

SRY

UniProt Synonym Gene Names

TDF

NCBI Protein Information

sex-determining region Y protein

NCBI Summary for SRY

This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome. [provided by RefSeq, Jul 2008]

UniProt Comments for SRY

Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells (). In male adult brain involved in the maintenance of motor functions of dopaminergic neurons (). Involved in different aspects of gene regulation including promoter activation or repression (). Promotes DNA bending. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'.

Research Articles on SRY

1. Activation of SRY and its downstream Sox9 and PDGFRalpha pathways are commonly involved in male hepatocarcinogenesis, which provides novel insights into gender disparity and sex-specific therapeutic strategies of hepatocellular carcinoma.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SRY antibody

Reference Product	PubMed Publications
SMAD3 antibody	>9 publications with SRY and SMAD3

Pathways associated with anti-SRY antibody

Products by Pathway	Pathway Diagram
Regulation Of Androgen Receptor Activity Pathway antibodies	Regulation Of Androgen Receptor Activity Pathway Diagram

Diseases associated with anti-SRY antibody

Disease Name	Pubmed Publications
Heart Diseases Antibodies	>129 publications with SRY and Heart Diseases
Nervous System Diseases Antibodies	>72 publications with SRY and Nervous System Diseases
Kidney Diseases Antibodies	>35 publications with SRY and Kidney Diseases
46,XY SEX REVERSAL 1 Antibodies	>34 publications with SRY and 46,XY SEX REVERSAL 1
Hyperplasia Antibodies	>31 publications with SRY and Hyperplasia
46,Xx Gonadal Dysgenesis, Complete, Sry-Positive Antibodies	>23 publications with SRY and 46,Xx Gonadal Dysgenesis, Complete, Sry-Positive
Liver Diseases Antibodies	>22 publications with SRY and Liver Diseases
Adenocarcinoma Antibodies	>21 publications with SRY and Adenocarcinoma
Necrosis Antibodies	>17 publications with SRY and Necrosis
Inflammation Antibodies	>14 publications with SRY and Inflammation