• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RanBP2 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750530

Description: RAN binding protein 2 (RANBP2) is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RanBP2, Polyclonal Antibody
Full Product Name
Anti-RanBP2 Picoband Antibody
Product Gene Name
anti-RanBP2 antibody
Product Synonym Names
E3 SUMO-protein ligase RanBP2; 6.3.2.-; 358 kDa nucleoporin; Nuclear pore complex protein Nup358; Nucleoporin Nup358; Ran-binding protein 2; RanBP2; p270; RANBP2; NUP358
Clonality
Polyclonal
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Form/Format
Lyophilized
Purity/Purification
Immunogen affinity purified
Concentration
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. (lot specific)
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
358199 MW
OMIM
L41840 Genomic DNA
3D Structure
ModBase 3D Structure for P49792
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human RanBP2 (3018-3057aa EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE), different from the related mouse sequence by nine amino acids.
Subcellular Localization
Nucleus. Nucleus membrane. Nucleus, nuclear pore complex. Detected in diffuse and discrete intranuclear foci (PubMed: 11839768). Cytoplasmic filaments (PubMed: 7775481).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Product Categories/Family for anti-RanBP2 antibody

Cell Biology; Cell Cycle; Cell Division; spindle; Cell Biology; Proteolysis/Ubiquitin; Proteasome/Ubiquitin; sumo; Signal Transduction; Protein Trafficking; nuclear import/export; Epigenetics and Nuclear Signaling; DNA/RNA; RNA Processing; ubiquitin & ubi
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-RanBP2 antibody
Western Blot (WB)
Application Notes for anti-RanBP2 antibody
WB: 0.1-0.5mug/ml

Western Blot (WB) of anti-RanBP2 antibody

Figure 1. Western blot analysis of RanBP2 using anti-RanBP2 antibody (MBS1750530).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysate,
Lane 2: mouse brain tissue lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RanBP2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for RanBP2 at approximately 270KD. The expected band size for RanBP2 is at 358KD.
Rabbit Anti-RanBP2 Polyclonal Antibody – Cat# MBS1750530

Other Notes

Small volumes of anti-RanBP2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RanBP2 purchase

MBS1750530 is an antibody targeting RanBP2. Also known as Anti-RanBP2 Picoband Antibody. Reactive in Human, Mouse, Rat
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for RanBP2. It may not necessarily be applicable to this product.

NCBI GI #
150418007
NCBI GeneID
5903
NCBI Accession #
NP_006258.3
UniProt Primary Accession #
P49792
UniProt Secondary Accession #
Q13074; Q15280; Q53TE2; Q59FH7
UniProt Related Accession #
P49792
GenBank Nucleotide #
NM_006267.4
NCBI Official Full Name
E3 SUMO-protein ligase RanBP2
NCBI Official Synonym Full Names
RAN binding protein 2
NCBI Official Symbol
RANBP2
NCBI Official Synonym Symbols
ANE1; TRP1; TRP2; ADANE; IIAE3; NUP358
UniProt Protein Name
E3 SUMO-protein ligase RanBP2
UniProt Synonym Protein Names
358 kDa nucleoporin; Nuclear pore complex protein Nup358; Nucleoporin Nup358; Ran-binding protein 2; RanBP2; p270
Protein Family
E3 SUMO-protein ligase
UniProt Gene Name
RANBP2
UniProt Synonym Gene Names
NUP358; RanBP2
NCBI Protein Information
E3 SUMO-protein ligase RanBP2

NCBI Summary for RanBP2

RAN is a small GTP-binding protein of the RAS superfamily that is associated with the nuclear membrane and is thought to control a variety of cellular functions through its interactions with other proteins. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. The encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for RanBP2

E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single-stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB. Recruits BICD2 to the nuclear envelope and cytoplasmic stacks of nuclear pore complex known as annulate lamellae during G2 phase of cell cycle (PubMed:20386726).
Show more

Research Articles on RanBP2

1. Translocation of p53 is regulated by androgen-dependent sumoylation mediated by the G3BP2-interacting SUMO-E3 ligase, RanBP2. G3BP2 knockdown results in reduced tumor growth and increased nuclear p53 accumulation in mouse xenograft models of prostate cancer with or without long-term androgen deprivation.
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RanBP2 antibody

 Reference Product  PubMed Publications
 SUMO1 antibody  >47 publications with RanBP2 and SUMO1
 RANGAP1 antibody  >45 publications with RanBP2 and RANGAP1
 SUMO2 antibody  >8 publications with RanBP2 and SUMO2
 SAE1 antibody  >4 publications with RanBP2 and SAE1
 KIF5B antibody  >4 publications with RanBP2 and KIF5B
 XPO1 antibody  >1 publications with RanBP2 and XPO1
 KPNB1 antibody  >1 publications with RanBP2 and KPNB1

Pathways associated with anti-RanBP2 antibody

 Products by Pathway  Pathway Diagram
 Antiviral Mechanism By IFN-stimulated Genes Pathway antibodies  Antiviral Mechanism By IFN-stimulated Genes Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle, Mitotic Pathway antibodies  Cell Cycle, Mitotic Pathway Diagram
 Cytokine Signaling In Immune System Pathway antibodies  Cytokine Signaling In Immune System Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Export Of Viral Ribonucleoproteins From Nucleus Pathway antibodies  Export Of Viral Ribonucleoproteins From Nucleus Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Glucose Transport Pathway antibodies  Glucose Transport Pathway Diagram
 Glycogen Storage Diseases Pathway antibodies  Glycogen Storage Diseases Pathway Diagram
 HIV Infection Pathway antibodies  HIV Infection Pathway Diagram

Diseases associated with anti-RanBP2 antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >4 publications with RanBP2 and Inflammation
 Liver Neoplasms Antibodies  >3 publications with RanBP2 and Liver Neoplasms
 Liver Diseases Antibodies  >3 publications with RanBP2 and Liver Diseases
 Lung Neoplasms Antibodies  >2 publications with RanBP2 and Lung Neoplasms
 Skin Diseases Antibodies  >2 publications with RanBP2 and Skin Diseases
 Neoplasms, Experimental Antibodies  >2 publications with RanBP2 and Neoplasms, Experimental
 Necrosis Antibodies  >2 publications with RanBP2 and Necrosis
 Cell Transformation, Neoplastic Antibodies  >1 publications with RanBP2 and Cell Transformation, Neoplastic
 Liver Neoplasms, Experimental Antibodies  >1 publications with RanBP2 and Liver Neoplasms, Experimental
 Hyperplasia Antibodies  >1 publications with RanBP2 and Hyperplasia

Organs/Tissues associated with anti-RanBP2 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >21 publications with RanBP2 and Brain
 Eye Antibodies  >14 publications with RanBP2 and Eye
 Muscle Antibodies  >7 publications with RanBP2 and Muscle
 Liver Antibodies  >6 publications with RanBP2 and Liver
 Lung Antibodies  >5 publications with RanBP2 and Lung
 Blood Antibodies  >5 publications with RanBP2 and Blood
 Bone Marrow Antibodies  >3 publications with RanBP2 and Bone Marrow
 Bone Antibodies  >3 publications with RanBP2 and Bone
 Testis Antibodies  >3 publications with RanBP2 and Testis
 Thymus Antibodies  >1 publications with RanBP2 and Thymus
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000