Rabbit Anti-KCNH1 Polyclonal Antibody – Cat# MBS1750552

Figure 1. Western blot analysis of KCNH1 using anti-KCNH1 antibody (MBS1750552).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human COLO-320 cell lysate,
Lane 2: human HepG2 cell lysate,
Lane 3: human A549 cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-KCNH1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for KCNH1 at approximately 150KD. The expected band size for KCNH1 is at 111KD.

KCNH1 Antibody – Rabbit Polyclonal

Name: KCNH1 Antibody; Polyclonal; Rabbit; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS1750552
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750552

Description: Potassium voltage-gated channel subfamily H member 1 is a protein that in humans is encoded by the KCNH1 gene. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

KCNH1, Polyclonal Antibody

Full Product Name

Anti-KCNH1 Picoband antibody

Product Gene Name

anti-KCNH1 antibody

Product Synonym Names

Potassium voltage-gated channel subfamily H member 1; Ether-a-go-go potassium channel 1

Clonality

Polyclonal

Host

Rabbit

Species Reactivity

Human, Mouse, Rat
No cross reactivity with other proteins.

Form/Format

Lyophilized

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

108,597 Da

OMIM

AJ001366 mRNA

3D Structure

ModBase 3D Structure for O95259

Immunogen

A synthetic peptide corresponding to a sequence of human KCNH1 (AKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKA).

Subcellular Localization

Cell membrane.

Tissue Specificity

Highly expressed in brain and in myoblasts at the onset of fusion, but not in other tissues. Detected in HeLa (cervical carcinoma), SH-SY5Y (neuroblastoma) and MCF-7 (epithelial tumor) cells, but not in normal epithelial cells.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-KCNH1 antibody

Western Blot (WB)

Application Notes for anti-KCNH1 antibody

WB: 0.1-0.5mug/ml

Other Notes

Small volumes of anti-KCNH1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for KCNH1 purchase

MBS1750552 is an antibody targeting KCNH1. Also known as Anti-KCNH1 Picoband antibody. Reactive in Human, Mouse, Rat
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for KCNH1. It may not necessarily be applicable to this product.

NCBI GI #

4504831

NCBI GeneID

3756

NCBI Accession #

NP_002229.1

UniProt Primary Accession #

O95259

UniProt Secondary Accession #

O76035; Q14CL3; B1AQ26

UniProt Related Accession #

O95259

GenBank Nucleotide #

NM_002238.3

NCBI Official Full Name

potassium voltage-gated channel subfamily H member 1 isoform 2

NCBI Official Synonym Full Names

potassium voltage-gated channel subfamily H member 1

NCBI Official Symbol

KCNH1

NCBI Official Synonym Symbols

EAG; EAG1; ZLS1; TMBTS; h-eag; hEAG1; Kv10.1

UniProt Protein Name

Potassium voltage-gated channel subfamily H member 1

UniProt Synonym Protein Names

Ether-a-go-go potassium channel 1

Protein Family

Potassium voltage-gated channel subfamily

UniProt Gene Name

KCNH1

UniProt Synonym Gene Names

; h-eag; hEAG1

NCBI Protein Information

potassium voltage-gated channel subfamily H member 1

NCBI Summary for KCNH1

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. It is activated at the onset of myoblast differentiation. The gene is highly expressed in brain and in myoblasts. Overexpression of the gene may confer a growth advantage to cancer cells and favor tumor cell proliferation. Alternative splicing of this gene results in two transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

UniProt Comments for KCNH1

Pore-forming (alpha) subunit of a voltage-gated delayed rectifier potassium channel (PubMed:9738473, PubMed:11943152, PubMed:10880439, PubMed:22732247, PubMed:25556795, PubMed:27325704, PubMed:27005320, PubMed:27618660). Channel properties are modulated by subunit assembly (PubMed:11943152). Mediates IK(NI) current in myoblasts (PubMed:9738473). Involved in the regulation of cell proliferation and differentiation, in particular adipogenic and osteogenic differentiation in bone marrow-derived mesenchymal stem cells (MSCs) (PubMed:23881642).

Research Articles on KCNH1

1. in this report, we present two independent screening campaigns in which we wanted to identify small molecules that bind to either the intracellular cytoplasmic amino terminal Per-Arnt-Sim (PAS) domain from the human EAG-related gene (ERG) channel or the amino or carboxy terminal globular domains from the mouse EAG1 channel, affecting their interaction.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-KCNH1 antibody

Reference Product	PubMed Publications
KCNH5 antibody	>10 publications with KCNH1 and KCNH5

Pathways associated with anti-KCNH1 antibody

Products by Pathway	Pathway Diagram
Neuronal System Pathway antibodies	Neuronal System Pathway Diagram
Potassium Channels Pathway antibodies	Potassium Channels Pathway Diagram
Voltage Gated Potassium Channels Pathway antibodies	Voltage Gated Potassium Channels Pathway Diagram

Diseases associated with anti-KCNH1 antibody

Disease Name	Pubmed Publications
Arrhythmias, Cardiac Antibodies	>25 publications with KCNH1 and Arrhythmias, Cardiac
Long QT Syndrome Antibodies	>22 publications with KCNH1 and Long QT Syndrome
Neoplasm Invasiveness Antibodies	>8 publications with KCNH1 and Neoplasm Invasiveness
Breast Neoplasms Antibodies	>8 publications with KCNH1 and Breast Neoplasms
Ventricular Dysfunction Antibodies	>3 publications with KCNH1 and Ventricular Dysfunction
Liver Diseases Antibodies	>3 publications with KCNH1 and Liver Diseases
Torsades de Pointes Antibodies	>3 publications with KCNH1 and Torsades de Pointes
Ventricular Fibrillation Antibodies	>3 publications with KCNH1 and Ventricular Fibrillation
Poisoning Antibodies	>3 publications with KCNH1 and Poisoning
Necrosis Antibodies	>2 publications with KCNH1 and Necrosis

Organs/Tissues associated with anti-KCNH1 antibody

Organ/Tissue Name	Pubmed Publications
Brain Antibodies	>24 publications with KCNH1 and Brain
Mammary Gland Antibodies	>1 publications with KCNH1 and Mammary Gland
Testis Antibodies	>1 publications with KCNH1 and Testis
Pituitary Gland Antibodies	>1 publications with KCNH1 and Pituitary Gland