Rabbit Anti-GJB1 Polyclonal Antibody – Cat# MBS1750553

Figure 1. Western blot analysis of Connexin 32/GJB1 using anti-Connexin 32/GJB1 antibody (MBS1750553).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat kidney tissue lysates,
Lane 2: mouse kidney tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Connexin 32/GJB1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Connexin 32/GJB1 at approximately 32KD. The expected band size for Connexin 32/GJB1 is at 32KD.

Connexin 32/GJB1 (GJB1) Antibody – Rabbit Polyclonal

Name: GJB1 Antibody; Polyclonal; Rabbit; Mouse/Rat/Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS1750553
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750553

Description: Gap junction beta-1 protein (GJB1), also known as connexin 32 (Cx32) is a transmembrane protein that in humans is encoded by the GJB1 gene. This gene encodes a member of the gap junction protein family. The gap junction proteins are… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Connexin 32/GJB1, Polyclonal Antibody

Full Product Name

Anti-Connexin 32/GJB1 Picoband antibody

Product Gene Name

anti-GJB1 antibody

Product Synonym Names

Gap junction beta-1 protein; Connexin-32; Cx32; GAP junction 28 kDa liver protein; GJB1; CX32

Clonality

Polyclonal

Host

Rabbit

Species Reactivity

Mouse, Rat
Predicted Reactivity: Human
No cross reactivity with other proteins.

Form/Format

Lyophilized

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

32,025 Da

OMIM

X04325 mRNA

3D Structure

ModBase 3D Structure for P08034

Immunogen

A synthetic peptide corresponding to a sequence of human Connexin 32/GJB1 (AMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVH).

Subcellular Localization

Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-GJB1 antibody

Western Blot (WB)

Application Notes for anti-GJB1 antibody

WB: 0.1-0.5mug/ml

Other Notes

Small volumes of anti-GJB1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GJB1 purchase

MBS1750553 is an antibody targeting GJB1. Also known as Anti-Connexin 32/GJB1 Picoband antibody. Reactive in Mouse, Rat
Predicted Reactivity: Human
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for GJB1. It may not necessarily be applicable to this product.

NCBI GI #

4504005

NCBI GeneID

2705

NCBI Accession #

NP_000157.1

UniProt Primary Accession #

P08034

UniProt Secondary Accession #

Q5U0S4; B2R8R2; D3DVV2

UniProt Related Accession #

P08034

GenBank Nucleotide #

NP_000157.1

NCBI Official Full Name

gap junction beta-1 protein

NCBI Official Synonym Full Names

gap junction protein beta 1

NCBI Official Symbol

GJB1

NCBI Official Synonym Symbols

CMTX; CX32; CMTX1

UniProt Protein Name

Gap junction beta-1 protein

UniProt Synonym Protein Names

Connexin-32; Cx32; GAP junction 28 kDa liver protein

Protein Family

Gap junction beta-1 protein

UniProt Gene Name

GJB1

UniProt Synonym Gene Names

CX32; Cx32

NCBI Protein Information

gap junction beta-1 protein

NCBI Summary for GJB1

This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Mutations in this gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Oct 2008]

UniProt Comments for GJB1

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Research Articles on GJB1

1. Study reports mutation frequency of GJB1 in 210 Hungarian Charcot-Marie-Tooth neuropathy (CMT) patients and phenotype comparison between male and female CMT X type 1 patients. 13 missense substitutions were found in GJB1; pathogenic alterations were found mainly in males. Statistical analysis of CMT X type 1 patients revealed a significant difference between genders regarding the age of onset, CMT and examination scores.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-GJB1 antibody

Reference Product	PubMed Publications
GJB2 antibody	>12 publications with GJB1 and GJB2

Pathways associated with anti-GJB1 antibody

Products by Pathway	Pathway Diagram
Calcium Regulation In The Cardiac Cell Pathway antibodies	Calcium Regulation In The Cardiac Cell Pathway Diagram
Gap Junction Assembly Pathway antibodies	Gap Junction Assembly Pathway Diagram
Gap Junction Trafficking Pathway antibodies	Gap Junction Trafficking Pathway Diagram
Gap Junction Trafficking And Regulation Pathway antibodies	Gap Junction Trafficking And Regulation Pathway Diagram
Membrane Trafficking Pathway antibodies	Membrane Trafficking Pathway Diagram
Oligomerization Of Connexins Into Connexons Pathway antibodies	Oligomerization Of Connexins Into Connexons Pathway Diagram
Transport Of Connexins Along The Secretory Pathway antibodies	Transport Of Connexins Along The Secretory Pathway Diagram

Diseases associated with anti-GJB1 antibody

Disease Name	Pubmed Publications
Neuromuscular Diseases Antibodies	>109 publications with GJB1 and Neuromuscular Diseases
Muscle Weakness Antibodies	>12 publications with GJB1 and Muscle Weakness
Brain Diseases Antibodies	>8 publications with GJB1 and Brain Diseases
Nerve Degeneration Antibodies	>6 publications with GJB1 and Nerve Degeneration
Disease Models, Animal Antibodies	>4 publications with GJB1 and Disease Models, Animal
Neoplasms Antibodies	>3 publications with GJB1 and Neoplasms
Pain Antibodies	>3 publications with GJB1 and Pain
Eye Diseases Antibodies	>2 publications with GJB1 and Eye Diseases
Charcot-Marie-Tooth disease, X-linked, 1 Antibodies	>2 publications with GJB1 and Charcot-Marie-Tooth disease, X-linked, 1
Reflex, Abnormal Antibodies	>1 publications with GJB1 and Reflex, Abnormal

Organs/Tissues associated with anti-GJB1 antibody

Organ/Tissue Name	Pubmed Publications
Brain Antibodies	>16 publications with GJB1 and Brain
Liver Antibodies	>4 publications with GJB1 and Liver
Heart Antibodies	>2 publications with GJB1 and Heart
Skin Antibodies	>2 publications with GJB1 and Skin
Embryonic Tissue Antibodies	>1 publications with GJB1 and Embryonic Tissue
Mammary Gland Antibodies	>1 publications with GJB1 and Mammary Gland
Testis Antibodies	>1 publications with GJB1 and Testis
Kidney Antibodies	>1 publications with GJB1 and Kidney
Pancreas Antibodies	>1 publications with GJB1 and Pancreas