Rabbit Anti-ASXL1 Polyclonal Antibody – Cat# MBS1750569

Figure 1. Western blot analysis of ASXL1 using anti-ASXL1 antibody (MBS1750569).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human COLO-320 whole cell lysates,
Lane 3: human 293T whole cell lysates,
Lane 4: human Jurkat whole cell lysates,
Lane 5: mouse testis tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ASXL1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ASXL1 at approximately 220KD. The expected band size for ASXL1 is at 165KD.

ASXL1 Antibody – Rabbit Polyclonal

Name: ASXL1 Antibody; Polyclonal; Rabbit; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS1750569
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750569

Description: Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ASXL1, Polyclonal Antibody

Full Product Name

Anti-ASXL1 Picoband antibody

Product Gene Name

anti-ASXL1 antibody

Product Synonym Names

Putative Polycomb group protein ASXL1; Additional sex combs-like protein 1; ASXL1; KIAA0978

Clonality

Polyclonal

Host

Rabbit

Species Reactivity

Human, Mouse, Rat
No cross reactivity with other proteins.

Form/Format

Lyophilized

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

53,374 Da

OMIM

AJ438952 mRNA

3D Structure

ModBase 3D Structure for Q8IXJ9

Immunogen

A synthetic peptide corresponding to a sequence of human ASXL1 (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE).

Subcellular Localization

Nucleus.

Tissue Specificity

Widely expressed at low level. Expressed in heart, brain, skeletal muscle, placenta, pancreas, spleen, prostate, small intestine, colon, peripheral blood, leukocytes, bone marrow and fetal liver. Highly expressed in testes.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-ASXL1 antibody

Western Blot (WB)

Application Notes for anti-ASXL1 antibody

WB: 0.1-0.5mug/ml

Other Notes

Small volumes of anti-ASXL1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ASXL1 purchase

MBS1750569 is an antibody targeting ASXL1. Also known as Anti-ASXL1 Picoband antibody. Reactive in Human, Mouse, Rat
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for ASXL1. It may not necessarily be applicable to this product.

NCBI GI #

29570782

NCBI GeneID

171023

NCBI Accession #

NP_056153.2

UniProt Primary Accession #

Q8IXJ9

UniProt Secondary Accession #

Q5JWS9; Q8IYY7; Q9H466; Q9NQF8; Q9UFJ0; Q9UFP8; Q9Y2I4; B2RP59

UniProt Related Accession #

Q8IXJ9

GenBank Nucleotide #

NM_015338.5

NCBI Official Full Name

putative Polycomb group protein ASXL1 isoform 1

NCBI Official Synonym Full Names

additional sex combs like 1, transcriptional regulator

NCBI Official Symbol

ASXL1

NCBI Official Synonym Symbols

MDS; BOPS

UniProt Protein Name

Putative Polycomb group protein ASXL1

UniProt Synonym Protein Names

Additional sex combs-like protein 1

Protein Family

Putative Polycomb group protein

UniProt Gene Name

ASXL1

UniProt Synonym Gene Names

KIAA0978

NCBI Protein Information

putative Polycomb group protein ASXL1

NCBI Summary for ASXL1

This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]

UniProt Comments for ASXL1

Probable Polycomb group (PcG) protein involved in transcriptional regulation mediated by ligand-bound nuclear hormone receptors, such as retinoic acid receptors (RARs) and peroxisome proliferator-activated receptor gamma (PPARG). Acts as coactivator of RARA and RXRA through association with NCOA1. Acts as corepressor for PPARG and suppresses its adipocyte differentiation-inducing activity (). Non-catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1).

Research Articles on ASXL1

1. Hypermethylation of the CTNNA1 promoter was associated with unfavorable karyotype, and possessed the higher frequency of coexisting with ASXL1 and RUNX1 mutations.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-ASXL1 antibody

Disease Name	Pubmed Publications
Cell Transformation, Neoplastic Antibodies	>9 publications with ASXL1 and Cell Transformation, Neoplastic
Anemia Antibodies	>5 publications with ASXL1 and Anemia
Genomic Instability Antibodies	>2 publications with ASXL1 and Genomic Instability
Death Antibodies	>2 publications with ASXL1 and Death
Nervous System Diseases Antibodies	>2 publications with ASXL1 and Nervous System Diseases
Breast Neoplasms Antibodies	>1 publications with ASXL1 and Breast Neoplasms
Anemia, Hemolytic Antibodies	>1 publications with ASXL1 and Anemia, Hemolytic
Skin Diseases Antibodies	>1 publications with ASXL1 and Skin Diseases
Hypertrophy Antibodies	>1 publications with ASXL1 and Hypertrophy
Splenomegaly Antibodies	>1 publications with ASXL1 and Splenomegaly

Organs/Tissues associated with anti-ASXL1 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>20 publications with ASXL1 and Blood
Bone Antibodies	>13 publications with ASXL1 and Bone
Bone Marrow Antibodies	>12 publications with ASXL1 and Bone Marrow
Embryonic Tissue Antibodies	>2 publications with ASXL1 and Embryonic Tissue
Spleen Antibodies	>1 publications with ASXL1 and Spleen
Thymus Antibodies	>1 publications with ASXL1 and Thymus
Connective Tissue Antibodies	>1 publications with ASXL1 and Connective Tissue
Testis Antibodies	>1 publications with ASXL1 and Testis
Prostate Antibodies	>1 publications with ASXL1 and Prostate
Brain Antibodies	>1 publications with ASXL1 and Brain