• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

TORC2 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750576

Description: CREB regulated transcription coactivator 2, also known as CRTC2, is a protein which in humans is encoded by the CRTC2 gene. This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
TORC2, Polyclonal Antibody
Full Product Name
Anti-TORC2 Picoband antibody
Product Gene Name
anti-TORC2 antibody
Product Synonym Gene Name
CRTC2
Product Synonym Names
CREB-regulated transcription coactivator 2; Transducer of regulated cAMP response element-binding protein 2; TORC-2; Transducer of CREB protein 2; CRTC2; TORC2
Clonality
Polyclonal
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Form/Format
Lyophilized
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
73,302 Da
OMIM
AY360172 mRNA
3D Structure
ModBase 3D Structure for Q53ET0
Immunogen
A synthetic peptide corresponding to a sequence of human TORC2 (EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTR).
Subcellular Localization
Cytoplasm.
Tissue Specificity
Most abundantly expressed in the thymus. Present in both B and T-lymphocytes. Highly expressed in HEK293T cells and in insulinomas. High levels also in spleen, ovary, muscle and lung, with highest levels in muscle. Lower levels found in brain, colon, heart, kidney, prostate, small intestine and stomach. Weak expression in liver and pancreas.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-TORC2 antibody
Western Blot (WB)
Application Notes for anti-TORC2 antibody
WB: 0.1-0.5mug/ml

Western Blot (WB) of anti-TORC2 antibody

Figure 1. Western blot analysis of TORC2 using anti-TORC2 antibody (MBS1750576).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human MCF-7 whole cell lysates,
Lane 3: human A375 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TORC2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for TORC2 at approximately 73KD. The expected band size for TORC2 is at 73KD.
Rabbit Anti-TORC2 Polyclonal Antibody – Cat# MBS1750576

Other Notes

Small volumes of anti-TORC2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for TORC2 purchase

MBS1750576 is an antibody targeting TORC2. Also known as Anti-TORC2 Picoband antibody. Reactive in Human, Mouse, Rat
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for TORC2. It may not necessarily be applicable to this product.

NCBI GI #
32171215
NCBI GeneID
200186
NCBI Accession #
NP_859066.1
UniProt Primary Accession #
Q53ET0
UniProt Secondary Accession #
Q6UUV8; Q7Z3X7; Q8N332
UniProt Related Accession #
Q53ET0
GenBank Nucleotide #
NM_181715.2
NCBI Official Full Name
CREB-regulated transcription coactivator 2
NCBI Official Synonym Full Names
CREB regulated transcription coactivator 2
NCBI Official Symbol
CRTC2
NCBI Official Synonym Symbols
TORC2; TORC-2
UniProt Protein Name
CREB-regulated transcription coactivator 2
UniProt Synonym Protein Names
Transducer of regulated cAMP response element-binding protein 2; TORC-2; Transducer of CREB protein 2
Protein Family
Target of rapamycin complex
UniProt Gene Name
CRTC2
UniProt Synonym Gene Names
TORC2; TORC-2; Transducer of CREB protein 2
NCBI Protein Information
CREB-regulated transcription coactivator 2

NCBI Summary for TORC2

This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and therefore play an important role in many cellular processes. Under basal conditions the encoded protein is phosphorylated by AMP-activated protein kinase or the salt-inducible kinases and is sequestered in the cytoplasm. Upon activation by elevated cAMP or calcium, the encoded protein translocates to the nucleus and increases target gene expression. Single nucleotide polymorphisms in this gene may increase the risk of type 2 diabetes. A pseudogene of this gene is located on the long arm of chromosome 5. [provided by RefSeq, Dec 2010]
Show more

UniProt Comments for TORC2

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates gluconeogenesis as a component of the LKB1/AMPK/TORC2 signaling pathway. Regulates the expression of specific genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR).
Show more

Research Articles on TORC2

1. Thyroid stimulating hormone activates CRTC2 via the TSHR/cAMP/PKA pathway.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-TORC2 antibody

 Reference Product  PubMed Publications
 CREB1 antibody  >19 publications with TORC2 and CREB1
 SIK2 antibody  >10 publications with TORC2 and SIK2
 SIK1 antibody  >6 publications with TORC2 and SIK1

Pathways associated with anti-TORC2 antibody

 Products by Pathway  Pathway Diagram
 AMPK Signaling Pathway antibodies  AMPK Signaling Pathway Diagram
 AMPK Signaling Pathway antibodies  AMPK Signaling Pathway Diagram
 AMPK Signaling Pathway antibodies  AMPK Signaling Pathway Diagram
 HTLV-I Infection Pathway antibodies  HTLV-I Infection Pathway Diagram
 HTLV-I Infection Pathway antibodies  HTLV-I Infection Pathway Diagram
 LKB1 Signaling Events Pathway antibodies  LKB1 Signaling Events Pathway Diagram
 PI3K-Akt Signaling Pathway antibodies  PI3K-Akt Signaling Pathway Diagram
 PI3K-Akt Signaling Pathway antibodies  PI3K-Akt Signaling Pathway Diagram

Diseases associated with anti-TORC2 antibody

 Disease Name  Pubmed Publications
 Hyperglycemia Antibodies  >21 publications with TORC2 and Hyperglycemia
 Carcinoma Antibodies  >14 publications with TORC2 and Carcinoma
 Kidney Diseases Antibodies  >14 publications with TORC2 and Kidney Diseases
 Cell Transformation, Neoplastic Antibodies  >12 publications with TORC2 and Cell Transformation, Neoplastic
 Neoplasms, Experimental Antibodies  >11 publications with TORC2 and Neoplasms, Experimental
 Lymphatic Diseases Antibodies  >10 publications with TORC2 and Lymphatic Diseases
 Fatty Liver Antibodies  >7 publications with TORC2 and Fatty Liver
 Neurodegenerative Diseases Antibodies  >7 publications with TORC2 and Neurodegenerative Diseases
 Liver Diseases Antibodies  >6 publications with TORC2 and Liver Diseases
 Liver Neoplasms Antibodies  >5 publications with TORC2 and Liver Neoplasms

Organs/Tissues associated with anti-TORC2 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >58 publications with TORC2 and Blood
 Liver Antibodies  >56 publications with TORC2 and Liver
 Kidney Antibodies  >24 publications with TORC2 and Kidney
 Brain Antibodies  >23 publications with TORC2 and Brain
 Muscle Antibodies  >19 publications with TORC2 and Muscle
 Vascular Antibodies  >15 publications with TORC2 and Vascular
 Lung Antibodies  >11 publications with TORC2 and Lung
 Pancreas Antibodies  >10 publications with TORC2 and Pancreas
 Embryonic Tissue Antibodies  >10 publications with TORC2 and Embryonic Tissue
 Prostate Antibodies  >10 publications with TORC2 and Prostate
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000