• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

FPRL1 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750734

Description: N-formyl peptide receptor 2 (FPR2) is a G-protein coupled receptor (GPCR) located on the surface of many cell types of various animal species. The human receptor protein is encoded by the FPR2 gene and is activated to regulate cell function by… More details

DISCONTINUED
Click here to view our similar product(s) OR click here to contact our technical support team for suitable replacement.
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Product Name
FPRL1, Polyclonal Antibody
Full Product Name
Anti-FPRL1 Picoband Antibody
Product Gene Name
anti-FPRL1 antibody
Product Synonym Gene Name
FPR2
Product Synonym Names
N-formyl peptide receptor 2; FMLP-related receptor I; FMLP-R-I; Formyl peptide receptor-like 1; HM63; Lipoxin A4 receptor; LXA4 receptor; RFP; FPR2; FPRH1; FPRL1; LXA4R
Clonality
Polyclonal
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Form/Format
Lyophilized
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
38,964 Da
OMIM
M76672 mRNA
3D Structure
ModBase 3D Structure for P25090
Immunogen
A synthetic peptide corresponding to a sequence of human FPRL1 (TIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR).
Subcellular Localization
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed abundantly in the lung and neutrophils. Also found in the spleen and testis.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-FPRL1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-FPRL1 antibody
WB: 0.1-0.5mug/ml
Immunohistochemistry (Paraffin-embedded Section): 0.5-1mug/ml

Western Blot (WB) of anti-FPRL1 antibody

Figure 1. Western blot analysis of FPRL1 using anti-FPRL1 antibody (MBS1750734).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat lung tissue lysates,
Lane 2: rat spleen tissue lysates,
Lane 3: rat blood lysates,
Lane 4: mouse lung tissue lysates,
Lane 5: mouse spleen tissue lysates.
Lane 6: mouse blood lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-FPRL1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for FPRL1 at approximately 85KD. The expected band size for FPRL1 is at 39KD.
Rabbit Anti-FPRL1 Polyclonal Antibody – Cat# MBS1750734

Immunohistochemistry (IHC) of anti-FPRL1 antibody

Figure 2. IHC analysis of FPRL1 using anti-FPRL1 antibody (MBS1750734).
FPRL1 was detected in paraffin-embedded section of mouse spleen tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2ug/ml rabbit anti-FPRL1 Antibody (MBS1750734) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Rabbit Anti-FPRL1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS1750734

Immunohistochemistry (IHC) of anti-FPRL1 antibody

Figure 3. IHC analysis of FPRL1 using anti-FPRL1 antibody (MBS1750734).
FPRL1 was detected in paraffin-embedded section of rat spleen tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2ug/ml rabbit anti-FPRL1 Antibody (MBS1750734) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Rabbit Anti-FPRL1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS1750734

Other Notes

Small volumes of anti-FPRL1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for FPRL1 purchase

MBS1750734 is an antibody targeting FPRL1. Also known as Anti-FPRL1 Picoband Antibody. Reactive in Human, Mouse, Rat
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for FPRL1. It may not necessarily be applicable to this product.

NCBI GI #
54112388
NCBI GeneID
2358
NCBI Accession #
NP_001005738.1
UniProt Primary Accession #
P25090
UniProt Secondary Accession #
A8K3E2
UniProt Related Accession #
P25090
GenBank Nucleotide #
NM_001005738.1
NCBI Official Full Name
N-formyl peptide receptor 2
NCBI Official Synonym Full Names
formyl peptide receptor 2
NCBI Official Symbol
FPR2
NCBI Official Synonym Symbols
ALXR; HM63; FMLPX; FPR2A; FPRH1; FPRH2; FPRL1; LXA4R; FMLP-R-II
UniProt Protein Name
N-formyl peptide receptor 2
UniProt Synonym Protein Names
FMLP-related receptor I; FMLP-R-I; Formyl peptide receptor-like 1; HM63; Lipoxin A4 receptor; LXA4 receptor; RFP
Protein Family
FPRL1 inhibitory protein
UniProt Gene Name
FPR2
UniProt Synonym Gene Names
FPRH1; FPRL1; LXA4R; FMLP-R-I; LXA4 receptor
NCBI Protein Information
N-formyl peptide receptor 2

UniProt Comments for FPRL1

Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in an anti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4).
Show more

Research Articles on FPRL1

1. plasma levels higher in preeclamptic women than in nonpregnant and normotensive pregnant women, and similar between nonpregnant and normotensive pregnant women

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-FPRL1 antibody

 Reference Product  PubMed Publications
 CAMP antibody  >9 publications with FPRL1 and CAMP

Pathways associated with anti-FPRL1 antibody

 Products by Pathway  Pathway Diagram
 Class A/1 (Rhodopsin-like Receptors) Pathway antibodies  Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
 Formyl Peptide Receptors Bind Formyl Peptides And Many Other Ligands Pathway antibodies  Formyl Peptide Receptors Bind Formyl Peptides And Many Other Ligands Pathway Diagram
 G Alpha (i) Signalling Events Pathway antibodies  G Alpha (i) Signalling Events Pathway Diagram
 G Alpha (q) Signalling Events Pathway antibodies  G Alpha (q) Signalling Events Pathway Diagram
 GPCR Downstream Signaling Pathway antibodies  GPCR Downstream Signaling Pathway Diagram
 GPCR Ligand Binding Pathway antibodies  GPCR Ligand Binding Pathway Diagram
 GPCRs, Class A Rhodopsin-like Pathway antibodies  GPCRs, Class A Rhodopsin-like Pathway Diagram
 Neuroactive Ligand-receptor Interaction Pathway antibodies  Neuroactive Ligand-receptor Interaction Pathway Diagram
 Neuroactive Ligand-receptor Interaction Pathway antibodies  Neuroactive Ligand-receptor Interaction Pathway Diagram
 Peptide GPCRs Pathway antibodies  Peptide GPCRs Pathway Diagram

Diseases associated with anti-FPRL1 antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >122 publications with FPRL1 and Inflammation
 Necrosis Antibodies  >21 publications with FPRL1 and Necrosis
 Neoplasms Antibodies  >21 publications with FPRL1 and Neoplasms
 Pain Antibodies  >14 publications with FPRL1 and Pain
 Vascular Diseases Antibodies  >12 publications with FPRL1 and Vascular Diseases
 Disease Models, Animal Antibodies  >12 publications with FPRL1 and Disease Models, Animal
 Lung Diseases Antibodies  >11 publications with FPRL1 and Lung Diseases
 Chronic Disease Antibodies  >11 publications with FPRL1 and Chronic Disease
 Cardiovascular Diseases Antibodies  >11 publications with FPRL1 and Cardiovascular Diseases
 Glioma Antibodies  >7 publications with FPRL1 and Glioma

Organs/Tissues associated with anti-FPRL1 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >146 publications with FPRL1 and Blood
 Lung Antibodies  >27 publications with FPRL1 and Lung
 Kidney Antibodies  >13 publications with FPRL1 and Kidney
 Bone Marrow Antibodies  >6 publications with FPRL1 and Bone Marrow
 Connective Tissue Antibodies  >5 publications with FPRL1 and Connective Tissue
 Spleen Antibodies  >5 publications with FPRL1 and Spleen
 Heart Antibodies  >2 publications with FPRL1 and Heart
 Testis Antibodies  >1 publications with FPRL1 and Testis
 Placenta Antibodies  >1 publications with FPRL1 and Placenta
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000