Rabbit Anti-PTGER4 Polyclonal Antibody – Cat# MBS1750748

Figure 1. Western blot analysis of PTGER4 using anti- PTGER4 antibody (MBS1750748).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: SW620 whole Cell lysates,
Lane 2: MCF-7 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- PTGER4 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PTGER4 at approximately 53KD. The expected band size for PTGER4 is at 53KD.

PTGER4 Antibody – Rabbit Polyclonal

Name: PTGER4 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS1750748
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750748

Description: Prostaglandin E2 receptor 4 (EP4) is a prostaglandin receptor encoded by the PTGER4 gene in humans. The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

PTGER4, Polyclonal Antibody

Full Product Name

Anti-PTGER4 Picoband Antibody

Product Gene Name

anti-PTGER4 antibody

Product Synonym Names

Prostaglandin E2 receptor EP4 subtype; PGE receptor EP4 subtype; PGE2 receptor EP4 subtype; Prostanoid EP4 receptor; PTGER4; PTGER2

Clonality

Polyclonal

Host

Rabbit

Species Reactivity

Human
No cross reactivity with other proteins.

Form/Format

Lyophilized

Purity/Purification

Immunogen affinity purified

Concentration

Add 0.2ml of distilled water will yield a concentration of 500ug/ml. (lot specific)

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

53119 MW

OMIM

L28175 mRNA

3D Structure

ModBase 3D Structure for P35408

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK), identical to the related mouse and rat sequences.

Subcellular Localization

Cell membrane; Multi-pass membrane protein.

Tissue Specificity

High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Product Categories/Family for anti-PTGER4 antibody

Signal Transduction; Signaling Pathway; Lipid Signaling; Prostaglandins; Signal Transduction; G Protein Signaling; gpcr

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-PTGER4 antibody

Western Blot (WB)

Application Notes for anti-PTGER4 antibody

WB: 0.1-0.5mug/ml

Other Notes

Small volumes of anti-PTGER4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PTGER4 purchase

MBS1750748 is an antibody targeting PTGER4. Also known as Anti-PTGER4 Picoband Antibody. Reactive in Human
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for PTGER4. It may not necessarily be applicable to this product.

NCBI GI #

4506259

NCBI GeneID

5734

NCBI Accession #

NP_000949.1

UniProt Primary Accession #

P35408

UniProt Secondary Accession #

Q3MJ87

UniProt Related Accession #

P35408

GenBank Nucleotide #

NM_000958.2

NCBI Official Full Name

prostaglandin E2 receptor EP4 subtype

NCBI Official Synonym Full Names

prostaglandin E receptor 4

NCBI Official Symbol

PTGER4

NCBI Official Synonym Symbols

EP4; EP4R

UniProt Protein Name

Prostaglandin E2 receptor EP4 subtype

UniProt Synonym Protein Names

Prostanoid EP4 receptor

Protein Family

Prostaglandin E2 receptor

UniProt Gene Name

PTGER4

UniProt Synonym Gene Names

PTGER2; PGE receptor EP4 subtype; PGE2 receptor EP4 subtype

NCBI Protein Information

prostaglandin E2 receptor EP4 subtype

NCBI Summary for PTGER4

The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1 (EGR1), regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses. [provided by RefSeq, Jul 2008]

UniProt Comments for PTGER4

Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.

Research Articles on PTGER4

1. Reprogramming of mammary epithelial cells can result from EP4 -mediated stem cell property transfer by extracellular vesicles/exosomes containing caveolae-associated proteins, between mammary basal and luminal epithelial cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-PTGER4 antibody

Products by Pathway	Pathway Diagram
Class A/1 (Rhodopsin-like Receptors) Pathway antibodies	Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
Eicosanoid Ligand-binding Receptors Pathway antibodies	Eicosanoid Ligand-binding Receptors Pathway Diagram
G Alpha (s) Signalling Events Pathway antibodies	G Alpha (s) Signalling Events Pathway Diagram
GPCR Downstream Signaling Pathway antibodies	GPCR Downstream Signaling Pathway Diagram
GPCR Ligand Binding Pathway antibodies	GPCR Ligand Binding Pathway Diagram
GPCRs, Class A Rhodopsin-like Pathway antibodies	GPCRs, Class A Rhodopsin-like Pathway Diagram
Neuroactive Ligand-receptor Interaction Pathway antibodies	Neuroactive Ligand-receptor Interaction Pathway Diagram
Neuroactive Ligand-receptor Interaction Pathway antibodies	Neuroactive Ligand-receptor Interaction Pathway Diagram
Prostaglandin Synthesis And Regulation Pathway antibodies	Prostaglandin Synthesis And Regulation Pathway Diagram
Prostanoid Ligand Receptors Pathway antibodies	Prostanoid Ligand Receptors Pathway Diagram

Diseases associated with anti-PTGER4 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>81 publications with PTGER4 and Neoplasms
Inflammation Antibodies	>76 publications with PTGER4 and Inflammation
Necrosis Antibodies	>46 publications with PTGER4 and Necrosis
Cardiovascular Diseases Antibodies	>36 publications with PTGER4 and Cardiovascular Diseases
Nervous System Diseases Antibodies	>26 publications with PTGER4 and Nervous System Diseases
Breast Neoplasms Antibodies	>14 publications with PTGER4 and Breast Neoplasms
Kidney Diseases Antibodies	>13 publications with PTGER4 and Kidney Diseases
Neoplasms, Experimental Antibodies	>13 publications with PTGER4 and Neoplasms, Experimental
Pain Antibodies	>11 publications with PTGER4 and Pain
Lung Neoplasms Antibodies	>10 publications with PTGER4 and Lung Neoplasms

Organs/Tissues associated with anti-PTGER4 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>115 publications with PTGER4 and Blood
Vascular Antibodies	>57 publications with PTGER4 and Vascular
Kidney Antibodies	>39 publications with PTGER4 and Kidney
Brain Antibodies	>33 publications with PTGER4 and Brain
Intestine Antibodies	>27 publications with PTGER4 and Intestine
Lung Antibodies	>26 publications with PTGER4 and Lung
Eye Antibodies	>22 publications with PTGER4 and Eye
Connective Tissue Antibodies	>19 publications with PTGER4 and Connective Tissue
Liver Antibodies	>18 publications with PTGER4 and Liver
Skin Antibodies	>15 publications with PTGER4 and Skin