• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MATH1/HATH1 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750755

Description: Protein atonal homolog 1 is a protein that in humans is encoded by the ATOH1 gene. This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. ATOH1 is… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MATH1/HATH1, Polyclonal Antibody
Full Product Name
Anti-MATH1/HATH1 Picoband Antibody
Product Gene Name
anti-MATH1/HATH1 antibody
Product Synonym Gene Name
ATOH1
Product Synonym Names
Protein atonal homolog 1; Class A basic helix-loop-helix protein 14; bHLHa14; Helix-loop-helix protein hATH-1; hATH1; ATOH1; ATH1; BHLHA14
Clonality
Polyclonal
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Form/Format
Lyophilized
Purity/Purification
Immunogen affinity purified
Concentration
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. (lot specific)
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
38160 MW
OMIM
U61148 Genomic DNA
3D Structure
ModBase 3D Structure for Q92858
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MATH1/HATH1 (1-30aa MSRLLHAEEWAEVKELGDHHRQPQPHHLPQ), different from the related mouse sequence by three amino acids.
Subcellular Localization
Nucleus.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Product Categories/Family for anti-MATH1/HATH1 antibody

Epigenetics and Nuclear Signaling; Transcription; Domain Families; HLH/Leucine Zipper; HLH; Neuroscience; Sensory System; auditory system; Neurology Process; Neurogenesis; Stem Cells; Signaling Pathways; notch; nuclear
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-MATH1/HATH1 antibody
Western Blot (WB)
Application Notes for anti-MATH1/HATH1 antibody
WB: 0.1-0.5mug/ml

Western Blot (WB) of anti-MATH1/HATH1 antibody

Figure 1. Western blot analysis of MATH1/HATH1 using anti-MATH1/HATH1 antibody (MBS1750755).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysate,
Lane 2: mouse brain tissue lysate
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MATH1/HATH1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MATH1/HATH1 at approximately 38KD. The expected band size for MATH1/HATH1 is at 38KD.
Rabbit Anti-MATH1/HATH1 Polyclonal Antibody – Cat# MBS1750755

Other Notes

Small volumes of anti-MATH1/HATH1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MATH1/HATH1 purchase

MBS1750755 is an antibody targeting MATH1/HATH1. Also known as Anti-MATH1/HATH1 Picoband Antibody. Reactive in Human, Mouse, Rat
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for MATH1/HATH1. It may not necessarily be applicable to this product.

NCBI GI #
4885075
NCBI GeneID
474
NCBI Accession #
NP_005163.1
UniProt Primary Accession #
Q92858
UniProt Secondary Accession #
Q14CT9
UniProt Related Accession #
Q92858
GenBank Nucleotide #
NM_005172.1
NCBI Official Full Name
protein atonal homolog 1
NCBI Official Synonym Full Names
atonal bHLH transcription factor 1
NCBI Official Symbol
ATOH1
NCBI Official Synonym Symbols
ATH1; HATH1; MATH-1; bHLHa14
UniProt Protein Name
Protein atonal homolog 1
UniProt Synonym Protein Names
Class A basic helix-loop-helix protein 14; bHLHa14; Helix-loop-helix protein hATH-1; hATH1
UniProt Gene Name
ATOH1
UniProt Synonym Gene Names
ATH1; BHLHA14; bHLHa14; hATH1
NCBI Protein Information
protein atonal homolog 1

NCBI Summary for MATH1/HATH1

This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq, Jul 2008]

UniProt Comments for MATH1/HATH1

Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription ().

Research Articles on MATH1/HATH1

1. ATOH1 expression was detected consistently in recurrent and metastatic SHH medulloblastoma. Chromatin immunoprecipitation sequencing and gene expression profiling identified candidate ATOH1 targets in tumor cells involved in development and tumorigenesis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MATH1/HATH1 antibody

 Reference Product  PubMed Publications
 SOX2 antibody  >28 publications with MATH1/HATH1 and SOX2
 PROX1 antibody  >7 publications with MATH1/HATH1 and PROX1
 HIC1 antibody  >5 publications with MATH1/HATH1 and HIC1
 TCF4 antibody  >3 publications with MATH1/HATH1 and TCF4
 MUC6 antibody  >2 publications with MATH1/HATH1 and MUC6
 ZIC1 antibody  >2 publications with MATH1/HATH1 and ZIC1
 HES6 antibody  >2 publications with MATH1/HATH1 and HES6
 POU4F1 antibody  >1 publications with MATH1/HATH1 and POU4F1

Diseases associated with anti-MATH1/HATH1 antibody

 Disease Name  Pubmed Publications
 Medulloblastoma Antibodies  >33 publications with MATH1/HATH1 and Medulloblastoma
 Brain Diseases Antibodies  >20 publications with MATH1/HATH1 and Brain Diseases
 Inflammation Antibodies  >8 publications with MATH1/HATH1 and Inflammation
 Colitis Antibodies  >7 publications with MATH1/HATH1 and Colitis
 Hyperplasia Antibodies  >5 publications with MATH1/HATH1 and Hyperplasia
 Necrosis Antibodies  >5 publications with MATH1/HATH1 and Necrosis
 Ataxia Antibodies  >4 publications with MATH1/HATH1 and Ataxia
 Lung Diseases Antibodies  >2 publications with MATH1/HATH1 and Lung Diseases
 Intracranial Hypertension Antibodies  >1 publications with MATH1/HATH1 and Intracranial Hypertension
 Hypertrophy Antibodies  >1 publications with MATH1/HATH1 and Hypertrophy

Organs/Tissues associated with anti-MATH1/HATH1 antibody

 Organ/Tissue Name  Pubmed Publications
 Mixed Antibodies  >1 publications with MATH1/HATH1 and Mixed
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000