Rabbit Anti-FBXL11 Polyclonal Antibody – Cat# MBS1750810

Figure 1. Western blot analysis of FBXL11 using anti-FBXL11 antibody (MBS1750810).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: mouse liver tissue lysates,
Lane 2: human A431 cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-FBXL11 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for FBXL11 at approximately 150KD. The expected band size for FBXL11 is at 133KD.

FBXL11 Antibody – Rabbit Polyclonal

Name: FBXL11 Antibody; Polyclonal; Rabbit; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS1750810
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750810

Description: Lysine-specific demethylase 2A (KDM2A) also known as F-box and leucine-rich repeat protein 11 (FBXL11) is an enzyme that in humans is encoded by the KDM2A gene. This gene encodes a member of the F-box protein family which is characterized by an… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

FBXL11, Polyclonal Antibody

Full Product Name

Anti-FBXL11 Picoband antibody

Product Gene Name

anti-FBXL11 antibody

Product Synonym Gene Name

KDM2A

Product Synonym Names

Lysine-specific demethylase 2A; CXXC-type zinc finger protein 8; F-box and leucine-rich repeat protein 11; F-box protein FBL7; F-box protein Lilina; F-box/LRR-repeat protein 11; JmjC domain-containing histone demethylation protein 1A; [Histone-H3]-lysine-36 demethylase 1A; KDM2A; CXXC8; FBL7; FBXL11; JHDM1A; KIAA1004

Clonality

Polyclonal

Host

Rabbit

Species Reactivity

Human, Mouse, Rat
No cross reactivity with other proteins.

Form/Format

Lyophilized

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

89,948 Da

OMIM

AB023221 mRNA

3D Structure

ModBase 3D Structure for Q9Y2K7

Immunogen

A synthetic peptide corresponding to a sequence of human FBXL11 (KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR).

Subcellular Localization

Nucleus, nucleoplasm.

Tissue Specificity

Widely expressed, with highest levels in brain, testis and ovary, followed by lung.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Product Categories/Family for anti-FBXL11 antibody

Epigenetics and Nuclear Signaling; Chromatin Modifying Enzymes; methylation; Epigenetics and Nuclear Signaling; jumonji containing proteins; lysine demethylation

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-FBXL11 antibody

Western Blot (WB)

Application Notes for anti-FBXL11 antibody

WB: 0.1-0.5mug/ml

Other Notes

Small volumes of anti-FBXL11 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for FBXL11 purchase

MBS1750810 is an antibody targeting FBXL11. Also known as Anti-FBXL11 Picoband antibody. Reactive in Human, Mouse, Rat
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for FBXL11. It may not necessarily be applicable to this product.

NCBI GI #

373938467

NCBI GeneID

22992

NCBI Accession #

NP_001243334.1

UniProt Primary Accession #

Q9Y2K7

UniProt Secondary Accession #

Q49A21; Q4G0M3; Q69YY8; Q9BVH5; Q9H7H5; Q9UK66; D4QA03; E9PIL6; I3VM55

GenBank Nucleotide #

NM_001256405.1

NCBI Official Full Name

lysine-specific demethylase 2A isoform b

UniProt Protein Name

Lysine-specific demethylase 2A

UniProt Synonym Protein Names

CXXC-type zinc finger protein 8; F-box and leucine-rich repeat protein 11; F-box protein FBL7; F-box protein Lilina; F-box/LRR-repeat protein 11; JmjC domain-containing histone demethylation protein 1A; [Histone-H3]-lysine-36 demethylase 1A

UniProt Gene Name

KDM2A

UniProt Synonym Gene Names

CXXC8; FBL7; FBXL11; JHDM1A; KIAA1004

UniProt Comments for FBXL11

Histone demethylase that specifically demethylates 'Lys-36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys-36'. May also recognize and bind to some phosphorylated proteins and promote their ubiquitination and degradation. Required to maintain the heterochromatic state. Associates with centromeres and represses transcription of small non-coding RNAs that are encoded by the clusters of satellite repeats at the centromere. Required to sustain centromeric integrity and genomic stability, particularly during mitosis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-FBXL11 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>6 publications with FBXL11 and Neoplasms
Leukemia Antibodies	>3 publications with FBXL11 and Leukemia
Leukemia, Myeloid, Acute Antibodies	>2 publications with FBXL11 and Leukemia, Myeloid, Acute
Lymphoma Antibodies	>2 publications with FBXL11 and Lymphoma
Leukemia, Myeloid Antibodies	>2 publications with FBXL11 and Leukemia, Myeloid
Anemia Antibodies	>1 publications with FBXL11 and Anemia
Inflammation Antibodies	>1 publications with FBXL11 and Inflammation
Necrosis Antibodies	>1 publications with FBXL11 and Necrosis
Lung Neoplasms Antibodies	>1 publications with FBXL11 and Lung Neoplasms

Organs/Tissues associated with anti-FBXL11 antibody

Organ/Tissue Name	Pubmed Publications
Brain Antibodies	>2 publications with FBXL11 and Brain
Spleen Antibodies	>1 publications with FBXL11 and Spleen
Prostate Antibodies	>1 publications with FBXL11 and Prostate
Bone Antibodies	>1 publications with FBXL11 and Bone
Thymus Antibodies	>1 publications with FBXL11 and Thymus
Connective Tissue Antibodies	>1 publications with FBXL11 and Connective Tissue
Testis Antibodies	>1 publications with FBXL11 and Testis
Lung Antibodies	>1 publications with FBXL11 and Lung