• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PODXL Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750830

Description: Podocalyxin-like protein 1 is a protein that in humans is encoded by the PODXL gene. This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes.… More details

DISCONTINUED
Click here to view our similar product(s) OR click here to contact our technical support team for suitable replacement.
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Product Name
PODXL, Polyclonal Antibody
Full Product Name
Anti-PODXL Picoband Antibody
Product Gene Name
anti-PODXL antibody
Product Synonym Names
Podocalyxin; GCTM-2 antigen; Gp200; Podocalyxin-like protein 1; PC; PCLP-1; PODXL; PCLP; PCLP1
Clonality
Polyclonal
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Form/Format
Lyophilized
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
55,386 Da
OMIM
U97519 mRNA
3D Structure
ModBase 3D Structure for O00592
Immunogen
A synthetic peptide corresponding to a sequence of human PODXL (HQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEKK).
Subcellular Localization
Apical cell membrane. Cell projection, lamellipodium. Cell projection, filopodium. Cell projection, ruffle. Cell projection, microvillus. Membrane raft. Membrane; In single attached epithelial cells is restricted to a preapical pole on the free plasma membrane whereas other apical and basolateral proteins are not yet polarized. Colocalizes with SLC9A3R2 at the apical plasma membrane during epithelial polarization. Colocalizes with SLC9A3R1 at the trans- Golgi network (transiently) and at the apical plasma membrane. Its association with the membrane raft is transient. Colocalizes with actin filaments, EZR and SLC9A3R1 in a punctate pattern at the apical cell surface where microvilli form. Colocalizes with EZR and SLC9A3R2 at the apical cell membrane of glomerular epithelium cells (By similarity). Forms granular, punctuated pattern, forming patches, preferentially adopting a polar distribution, located on the migrating poles of the cell or forming clusters along the terminal ends of filipodia establishing contact with the endothelial cells. Colocalizes with the submembrane actin of lamellipodia, particularly associated with ruffles. Colocalizes with vinculin at protrusions of cells. Colocalizes with ITGB1. Colocalizes with PARD3, PRKCI, EXOC5, OCLN, RAB11A and RAB8A in apical membrane initiation sites (AMIS) during the generation of apical surface and luminogenesis (By similarity).
Tissue Specificity
Glomerular epithelium cell (podocyte).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-PODXL antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-PODXL antibody
WB: 0.1-0.5mug/ml
Immunohistochemistry (Paraffin-embedded Section): 0.5-1mug/ml

Western Blot (WB) of anti-PODXL antibody

Figure 1. Western blot analysis of PODXL using anti-PODXL antibody (MBS1750830).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: mouse kidney tissue lysates,
Lane 2: mouse kidney tissue lysates,
Lane 3: mouse brain tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PODXL antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for PODXL at approximately 58KD. The expected band size for PODXL is at 58KD.
Rabbit Anti-PODXL Polyclonal Antibody – Cat# MBS1750830

Immunohistochemistry (IHC) of anti-PODXL antibody

Figure 2. IHC analysis of PODXL using anti-PODXL antibody (MBS1750830).
PODXL was detected in paraffin-embedded section of mouse kidney tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PODXL Antibody (MBS1750830) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Rabbit Anti-PODXL Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS1750830

Immunohistochemistry (IHC) of anti-PODXL antibody

Figure 3. IHC analysis of PODXL using anti-PODXL antibody (MBS1750830).
PODXL was detected in paraffin-embedded section of rat kidney tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PODXL Antibody (MBS1750830) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Rabbit Anti-PODXL Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS1750830

Other Notes

Small volumes of anti-PODXL antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PODXL purchase

MBS1750830 is an antibody targeting PODXL. Also known as Anti-PODXL Picoband Antibody. Reactive in Human, Mouse, Rat
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for PODXL. It may not necessarily be applicable to this product.

NCBI GI #
66277202
NCBI GeneID
5420
NCBI Accession #
NP_001018121.1
UniProt Primary Accession #
O00592
UniProt Secondary Accession #
Q52LZ7; Q53ER6; A6NHX8
UniProt Related Accession #
O00592
GenBank Nucleotide #
NM_001018111.2
NCBI Official Full Name
podocalyxin isoform 1
NCBI Official Synonym Full Names
podocalyxin like
NCBI Official Symbol
PODXL
NCBI Official Synonym Symbols
PC; PCLP; Gp200; PCLP-1
UniProt Protein Name
Podocalyxin
UniProt Synonym Protein Names
GCTM-2 antigen; Gp200; Podocalyxin-like protein 1; PC; PCLP-1
Protein Family
Podocalyxin
UniProt Gene Name
PODXL
UniProt Synonym Gene Names
PCLP; PCLP1; PC; PCLP-1
NCBI Protein Information
podocalyxin

NCBI Summary for PODXL

This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for PODXL

Involved in the regulation of both adhesion and cell morphology and cancer progression. Function as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up inital epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.
Show more

Research Articles on PODXL

1. Podocalyxin as a major pluripotent marker and novel keratan sulfate proteoglycan in human embryonic and induced pluripotent stem cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PODXL antibody

 Reference Product  PubMed Publications
 CD34 antibody  >10 publications with PODXL and CD34

Diseases associated with anti-PODXL antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >18 publications with PODXL and Neoplasms
 Kidney Diseases Antibodies  >7 publications with PODXL and Kidney Diseases
 Carcinoma Antibodies  >6 publications with PODXL and Carcinoma
 Liver Neoplasms Antibodies  >3 publications with PODXL and Liver Neoplasms
 Breast Neoplasms Antibodies  >2 publications with PODXL and Breast Neoplasms
 Cardiovascular Diseases Antibodies  >2 publications with PODXL and Cardiovascular Diseases
 Proteinuria Antibodies  >2 publications with PODXL and Proteinuria
 Heart Diseases Antibodies  >2 publications with PODXL and Heart Diseases
 Liver Diseases Antibodies  >2 publications with PODXL and Liver Diseases
 Ovarian Neoplasms Antibodies  >2 publications with PODXL and Ovarian Neoplasms

Organs/Tissues associated with anti-PODXL antibody

 Organ/Tissue Name  Pubmed Publications
 Kidney Antibodies  >16 publications with PODXL and Kidney
 Blood Antibodies  >14 publications with PODXL and Blood
 Vascular Antibodies  >10 publications with PODXL and Vascular
 Bone Antibodies  >10 publications with PODXL and Bone
 Embryonic Tissue Antibodies  >6 publications with PODXL and Embryonic Tissue
 Muscle Antibodies  >4 publications with PODXL and Muscle
 Lung Antibodies  >4 publications with PODXL and Lung
 Liver Antibodies  >4 publications with PODXL and Liver
 Heart Antibodies  >4 publications with PODXL and Heart
 Umbilical Cord Antibodies  >3 publications with PODXL and Umbilical Cord
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000