Rabbit Anti-HtrA3 Polyclonal Antibody – Cat# MBS1750899

Figure 1. Western blot analysis of HtrA3 using anti- HtrA3 antibody (MBS1750899).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: PANC-1 whole Cell lysates,
Lane 2: HEPG2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- HtrA3 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for HtrA3 at approximately 49KD. The expected band size for HtrA3 is at 49KD.

HtrA3 Antibody – Rabbit Polyclonal

Name: HtrA3 Antibody; Polyclonal; Rabbit; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS1750899
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750899

Description: Human HtrA3 protease, which induces mitochondria-mediated apoptosis, can be a tumor suppressor and a potential therapeutic target in the treatment of cancer. It may also have a role in ovarian development, granulosa cell differentiation and… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

HtrA3, Polyclonal Antibody

Full Product Name

Anti-HtrA3 Picoband Antibody

Product Gene Name

anti-HtrA3 antibody

Product Synonym Names

Serine protease HTRA3; 3.4.21.-; High-temperature requirement factor A3; Pregnancy-related serine protease; HTRA3; PRSP

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human

Form/Format

Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen affinity purified

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

OMIM

AY280665 mRNA

3D Structure

ModBase 3D Structure for P83110

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human HtrA3 (330-362aa FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-HtrA3 antibody

Western Blot (WB)

Application Notes for anti-HtrA3 antibody

WB: Concentration: 0.1-0.5ug/ml; Tested Species: Human
Tested Species with positve results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.

Other Notes

Small volumes of anti-HtrA3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HtrA3 purchase

MBS1750899 is an antibody targeting HtrA3. Also known as Anti-HtrA3 Picoband Antibody. Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for HtrA3. It may not necessarily be applicable to this product.

NCBI GI #

662236739

NCBI GeneID

94031

NCBI Accession #

NP_001284488.1

UniProt Primary Accession #

P83110

UniProt Secondary Accession #

Q7Z7A2

UniProt Related Accession #

P83110

GenBank Nucleotide #

NM_001297559.1

NCBI Official Full Name

serine protease HTRA3 isoform 2

NCBI Official Synonym Full Names

HtrA serine peptidase 3

NCBI Official Symbol

HTRA3

NCBI Official Synonym Symbols

Prsp; Tasp

UniProt Protein Name

Serine protease HTRA3

UniProt Synonym Protein Names

High-temperature requirement factor A3; Pregnancy-related serine protease

Protein Family

Serine protease

UniProt Gene Name

HTRA3

UniProt Synonym Gene Names

PRSP

NCBI Protein Information

serine protease HTRA3

UniProt Comments for HtrA3

Serine protease that cleaves beta-casein/CSN2 as well as several extracellular matrix (ECM) proteoglycans such as decorin/DCN, biglycan/BGN and fibronectin/FN1. Inhibits signaling mediated by TGF-beta family proteins possibly indirectly by degradation of these ECM proteoglycans (). May act as a tumor suppressor. Negatively regulates, in vitro, trophoblast invasion during placental development and may be involved in the development of the placenta in vivo. May also have a role in ovarian development, granulosa cell differentiation and luteinization (PubMed:21321049, PubMed:22229724).

Research Articles on HtrA3

1. HTRA3 suppresses tumor cell invasiveness and may serve as a prognostic biomarker for postoperative recurrence or survival in NSCLC

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-HtrA3 antibody

Disease Name	Pubmed Publications
Death Antibodies	>6 publications with HtrA3 and Death
Ovarian Diseases Antibodies	>3 publications with HtrA3 and Ovarian Diseases
Nervous System Diseases Antibodies	>2 publications with HtrA3 and Nervous System Diseases
Lung Diseases Antibodies	>2 publications with HtrA3 and Lung Diseases
Lung Neoplasms Antibodies	>2 publications with HtrA3 and Lung Neoplasms
Breast Neoplasms Antibodies	>2 publications with HtrA3 and Breast Neoplasms
Kidney Diseases Antibodies	>1 publications with HtrA3 and Kidney Diseases
Necrosis Antibodies	>1 publications with HtrA3 and Necrosis
Inflammation Antibodies	>1 publications with HtrA3 and Inflammation

Organs/Tissues associated with anti-HtrA3 antibody

Organ/Tissue Name	Pubmed Publications
Placenta Antibodies	>11 publications with HtrA3 and Placenta
Uterus Antibodies	>7 publications with HtrA3 and Uterus
Embryonic Tissue Antibodies	>7 publications with HtrA3 and Embryonic Tissue
Ovary Antibodies	>6 publications with HtrA3 and Ovary
Bone Antibodies	>5 publications with HtrA3 and Bone
Muscle Antibodies	>3 publications with HtrA3 and Muscle
Kidney Antibodies	>3 publications with HtrA3 and Kidney
Heart Antibodies	>2 publications with HtrA3 and Heart
Brain Antibodies	>2 publications with HtrA3 and Brain
Intestine Antibodies	>2 publications with HtrA3 and Intestine