• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

P2RY5 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750902

Description: Lysophosphatidic acid receptor 6 also known as LPA6, P2RY5, and GPR87, is a protein that in humans is encoded by the LPAR6 gene. The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
P2RY5, Polyclonal Antibody
Full Product Name
Anti-P2RY5 Picoband antibody
Product Gene Name
anti-P2RY5 antibody
Product Synonym Gene Name
LPAR6
Product Synonym Names
Lysophosphatidic acid receptor 6; LPA receptor 6; LPA-6; Oleoyl-L-alpha-lysophosphatidic acid receptor; P2Y purinoceptor 5; P2Y5; Purinergic receptor 5; RB intron encoded G-protein coupled receptor; LPAR6; P2RY5
Clonality
Polyclonal
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Form/Format
Lyophilized
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
39,392 Da
OMIM
L11910 Genomic DNA
3D Structure
ModBase 3D Structure for P43657
Immunogen
A synthetic peptide corresponding to a sequence of human P2RY5 (DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK).
Subcellular Localization
Cell membrane.
Tissue Specificity
Expressed ubiquitously, including in skin and hair follicle cells. Detected in both Henle's and Huxley's layers of the inner root sheath of the hair follicle and in suprabasal layers of the epidermis (at protein level). Expressed at low levels in peripheral blood leukocytes.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-P2RY5 antibody
Western Blot (WB)
Application Notes for anti-P2RY5 antibody
WB: 0.1-0.5mug/ml

Western Blot (WB) of anti-P2RY5 antibody

Figure 1. Western blot analysis of P2RY5 using anti-P2RY5 antibody (MBS1750902).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human MCF-7 whole cell lysates,
Lane 2: human HepG2 whole cell lysates,
Lane 3: human SK-OV-3 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-P2RY5 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for P2RY5 at approximately 43KD. The expected band size for P2RY5 is at 39KD.
Rabbit Anti-P2RY5 Polyclonal Antibody – Cat# MBS1750902

Other Notes

Small volumes of anti-P2RY5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for P2RY5 purchase

MBS1750902 is an antibody targeting P2RY5. Also known as Anti-P2RY5 Picoband antibody. Reactive in Human, Mouse, Rat
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for P2RY5. It may not necessarily be applicable to this product.

NCBI GI #
241982706
NCBI GeneID
10161
NCBI Accession #
NP_001155969.1
UniProt Primary Accession #
P43657
UniProt Secondary Accession #
O15133; Q3KPF5; Q53FA0; Q5VW44; Q7Z3S0; Q7Z3S6; A4FTW9; B3KVF2; F2YGU4
UniProt Related Accession #
P43657
GenBank Nucleotide #
NM_001162497.1
NCBI Official Full Name
lysophosphatidic acid receptor 6
NCBI Official Synonym Full Names
lysophosphatidic acid receptor 6
NCBI Official Symbol
LPAR6
NCBI Official Synonym Symbols
LAH3; P2Y5; ARWH1; HYPT8; P2RY5
UniProt Protein Name
Lysophosphatidic acid receptor 6
UniProt Synonym Protein Names
Oleoyl-L-alpha-lysophosphatidic acid receptor; P2Y purinoceptor 5; P2Y5; Purinergic receptor 5; RB intron encoded G-protein coupled receptor
UniProt Gene Name
LPAR6
UniProt Synonym Gene Names
P2RY5; LPA receptor 6; LPA-6; P2Y5
NCBI Protein Information
lysophosphatidic acid receptor 6

NCBI Summary for P2RY5

The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2009]
Show more

UniProt Comments for P2RY5

Binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is involved in the receptor activation. Important for the maintenance of hair growth and texture.

Research Articles on P2RY5

1. LPA2 mRNA levels were associated with poorer differentiation, and higher LPA6 levels were associated with microvascular invasion in HCC; both became a risk factor for recurrence after surgical treatment when combined with increased serum ATX levels

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-P2RY5 antibody

 Products by Pathway  Pathway Diagram
 Class A/1 (Rhodopsin-like Receptors) Pathway antibodies  Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
 G Alpha (q) Signalling Events Pathway antibodies  G Alpha (q) Signalling Events Pathway Diagram
 GPCR Downstream Signaling Pathway antibodies  GPCR Downstream Signaling Pathway Diagram
 GPCR Ligand Binding Pathway antibodies  GPCR Ligand Binding Pathway Diagram
 GPCRs, Class A Rhodopsin-like Pathway antibodies  GPCRs, Class A Rhodopsin-like Pathway Diagram
 Gastrin-CREB Signalling Pathway Via PKC And MAPK antibodies  Gastrin-CREB Signalling Pathway Via PKC And MAPK Diagram
 Neuroactive Ligand-receptor Interaction Pathway antibodies  Neuroactive Ligand-receptor Interaction Pathway Diagram
 Neuroactive Ligand-receptor Interaction Pathway antibodies  Neuroactive Ligand-receptor Interaction Pathway Diagram
 Nucleotide GPCRs Pathway antibodies  Nucleotide GPCRs Pathway Diagram
 Nucleotide-like (purinergic) Receptors Pathway antibodies  Nucleotide-like (purinergic) Receptors Pathway Diagram

Diseases associated with anti-P2RY5 antibody

 Disease Name  Pubmed Publications
 Hypotrichosis Antibodies  >9 publications with P2RY5 and Hypotrichosis
 Adenocarcinoma Antibodies  >2 publications with P2RY5 and Adenocarcinoma
 Carcinoma Antibodies  >2 publications with P2RY5 and Carcinoma
 Neoplasms Antibodies  >2 publications with P2RY5 and Neoplasms
 Congenital Abnormalities Antibodies  >1 publications with P2RY5 and Congenital Abnormalities
 Liver Diseases Antibodies  >1 publications with P2RY5 and Liver Diseases
 Intestinal Neoplasms Antibodies  >1 publications with P2RY5 and Intestinal Neoplasms
 Carcinoma, Hepatocellular Antibodies  >1 publications with P2RY5 and Carcinoma, Hepatocellular
 Liver Neoplasms Antibodies  >1 publications with P2RY5 and Liver Neoplasms
 Hypotrichosis simplex Antibodies  >1 publications with P2RY5 and Hypotrichosis simplex

Organs/Tissues associated with anti-P2RY5 antibody

 Organ/Tissue Name  Pubmed Publications
 Skin Antibodies  >1 publications with P2RY5 and Skin
 Nerve Antibodies  >1 publications with P2RY5 and Nerve
 Blood Antibodies  >1 publications with P2RY5 and Blood
 Liver Antibodies  >1 publications with P2RY5 and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000