Rabbit Anti-RECK Polyclonal Antibody – Cat# MBS1750910

Figure 1. Western blot analysis of RECK using anti-RECK antibody (MBS1750910).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human placenta tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RECK antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for RECK at approximately 106KD. The expected band size for RECK is at 106KD.

RECK Antibody – Rabbit Polyclonal

Name: RECK Antibody; Polyclonal; Rabbit; Human/Mouse-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS1750910
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1750910

Description: Reversion-inducing-cysteine-rich protein with kazal motifs, also known as RECK, is a human gene, thought to be a metastasis suppressor. The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like… More details

DISCONTINUED
Click here to view our similar product(s) OR click here to contact our technical support team for suitable replacement.

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Product Name

RECK, Polyclonal Antibody

Full Product Name

Anti-RECK Picoband antibody

Product Gene Name

anti-RECK antibody

Product Synonym Names

Reversion-inducing cysteine-rich protein with Kazal motifs; hRECK; Suppressor of tumorigenicity 15 protein; RECK; ST15

Clonality

Polyclonal

Host

Rabbit

Species Reactivity

Human, Mouse
No cross reactivity with other proteins.

Form/Format

Lyophilized

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

106,457 Da

OMIM

D50406 mRNA

3D Structure

ModBase 3D Structure for O95980

Immunogen

A synthetic peptide corresponding to a sequence of human RECK (NAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIA).

Subcellular Localization

Cell membrane; Lipid-anchor, GPI-anchor.

Tissue Specificity

Expressed in various tissues and untransformed cells. It is undetectable in tumor-derived cell lines and oncogenically transformed cells.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Product Categories/Family for anti-RECK antibody

Cancer; Oncoproteins/Suppressors; Tumor Suppressors; Cell Biology; Proteolysis/Ubiquitin; Protease Inhibitors; Serine Protease Inhibitors; Reck

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-RECK antibody

Western Blot (WB)

Application Notes for anti-RECK antibody

WB: 0.1-0.5mug/ml

Other Notes

Small volumes of anti-RECK antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RECK purchase

MBS1750910 is an antibody targeting RECK. Also known as Anti-RECK Picoband antibody. Reactive in Human, Mouse
No cross reactivity with other proteins.. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for RECK. It may not necessarily be applicable to this product.

NCBI GI #

11863156

NCBI GeneID

8434

NCBI Accession #

NP_066934.1

UniProt Primary Accession #

O95980

UniProt Secondary Accession #

Q5W0K6; Q8WX37; B2RNS1

UniProt Related Accession #

O95980

GenBank Nucleotide #

NM_021111.2

NCBI Official Full Name

reversion-inducing cysteine-rich protein with Kazal motifs isoform 1

NCBI Official Synonym Full Names

reversion inducing cysteine rich protein with kazal motifs

NCBI Official Symbol

RECK

NCBI Official Synonym Symbols

ST15

UniProt Protein Name

Reversion-inducing cysteine-rich protein with Kazal motifs

UniProt Synonym Protein Names

Suppressor of tumorigenicity 15 protein

Protein Family

Reversion-inducing cysteine-rich protein

UniProt Gene Name

RECK

UniProt Synonym Gene Names

ST15; hRECK

NCBI Protein Information

reversion-inducing cysteine-rich protein with Kazal motifs

NCBI Summary for RECK

The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]

UniProt Comments for RECK

Negatively regulates matrix metalloproteinase-9 (MMP-9) by suppressing MMP-9 secretion and by direct inhibition of its enzymatic activity. RECK down-regulation by oncogenic signals may facilitate tumor invasion and metastasis. Appears to also regulate MMP-2 and MT1-MMP, which are involved in cancer progression.

Research Articles on RECK

1. The expression of RECK in human healthy and diseased gingiva may contribute to periodontal physiological and pathological processes; low RECK expression may be associated with the enhanced MMP-2 and MMP-9 production in inflamed gingiva.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RECK antibody

Reference Product	PubMed Publications
MMP9 antibody	>13 publications with RECK and MMP9
MMP2 antibody	>10 publications with RECK and MMP2
MMP14 antibody	>7 publications with RECK and MMP14
TIMP2 antibody	>5 publications with RECK and TIMP2
ERBB2 antibody	>4 publications with RECK and ERBB2
HIF1A antibody	>3 publications with RECK and HIF1A
ANGPT1 antibody	>1 publications with RECK and ANGPT1

Pathways associated with anti-RECK antibody

Products by Pathway	Pathway Diagram
MicroRNAs In Cancer Pathway antibodies	MicroRNAs In Cancer Pathway Diagram
MicroRNAs In Cancer Pathway antibodies	MicroRNAs In Cancer Pathway Diagram

Diseases associated with anti-RECK antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>325 publications with RECK and Neoplasms
Lung Neoplasms Antibodies	>128 publications with RECK and Lung Neoplasms
Carcinoma, Non-Small-Cell Lung Antibodies	>96 publications with RECK and Carcinoma, Non-Small-Cell Lung
Neoplasm Metastasis Antibodies	>68 publications with RECK and Neoplasm Metastasis
Nervous System Diseases Antibodies	>66 publications with RECK and Nervous System Diseases
Neoplasm Invasiveness Antibodies	>55 publications with RECK and Neoplasm Invasiveness
Adenocarcinoma Antibodies	>45 publications with RECK and Adenocarcinoma
Drug Toxicity Antibodies	>42 publications with RECK and Drug Toxicity
Brain Diseases Antibodies	>30 publications with RECK and Brain Diseases
Neoplasms, Experimental Antibodies	>23 publications with RECK and Neoplasms, Experimental