Rabbit Anti-CALCA Polyclonal Antibody – Cat# MBS1751418

Figure 1. IHC analysis of Calcitonin using anti-Calcitonin antibody.
Calcitonin was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/mL rabbit anti-Calcitonin Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.

Calcitonin/Calca (CALCA) Antibody – Rabbit Polyclonal

Name: CALCA Antibody; Polyclonal; Rabbit; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS1751418
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1751418

Description: Rabbit IgG polyclonal antibody for Calcitonin detection. Tested with IHC-P in Human; Mouse; Rat.Background: Calcitonin, also known as CALCA, is a peptide hormone synthesized by the parafollicular cells of the thyroid. It is mapped to 11p15.2.… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Calcitonin/Calca, Polyclonal Antibody

Full Product Name

Anti-Calcitonin/Calca Antibody

Product Gene Name

anti-Calca antibody

Product Synonym Names

Calcitonin; Calca; Calc; Calcitonin-related polypeptide, alpha

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human, Mouse, Rat

Form/Format

Lyophilized

Purity/Purification

Immunogen Affinity Purified

Specificity

No cross reactivity with other proteins.

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.

Molecular Weight

14,065 Da

3D Structure

ModBase 3D Structure for P70160

Immunogen

A synthetic peptide corresponding to a sequence of mouse Calcitonin (CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP).

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Relevant Detection Systems

It is recommended to use HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-Calca antibody

Immunohistochemistry (IHC) Paraffin

Application Notes for anti-Calca antibody

IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.

Product References and Citations for anti-Calca antibody

1. Alevizaki, M., Stevenson, J. C., Girgis, S. I., MacIntyre, I., Legon, S. Altered calcitonin gene in a young patient with osteoporosis.Brit. Med. J. 298: 1215-1216, 1989. Note: Retraction: Brit. Med. J. 299: 235 only, 1989. 2. Breimer, L. H., MacIntyre, I., Zaidi, M. Peptides from the calcitonin genes: molecular genetics, structure and function. Biochem. J. 255: 377-390, 1988. 3. Edbrooke, M. R., Parker, D., McVey, J. H., Riley, J. H., Sorenson, G. D., Pettengill, O. S., Craig, R. K. Expression of the human calcitonin/CGRP gene in lung and thyroid carcinoma. EMBO J. 4: 715-724, 1985.

Other Notes

Small volumes of anti-Calca antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for Calca purchase

MBS1751418 is an antibody targeting Calca. Also known as Anti-Calcitonin/Calca Antibody. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for Calca. It may not necessarily be applicable to this product.

NCBI GI #

779176916

NCBI GeneID

12310

NCBI Accession #

NP_001292545.1

UniProt Primary Accession #

P70160

UniProt Secondary Accession #

Q8K1K5

UniProt Related Accession #

P70160; Q99JA0

GenBank Nucleotide #

NM_001305616.1

NCBI Official Full Name

calcitonin gene-related peptide 1 isoform Calca preproprotein

NCBI Official Synonym Full Names

calcitonin/calcitonin-related polypeptide, alpha

NCBI Official Symbol

Calca

NCBI Official Synonym Symbols

CA; Ct; Ctn; Calc; Cgrp; CGRP1; Calc1; CGRP-1

UniProt Protein Name

Calcitonin

Protein Family

Calcitonin

UniProt Gene Name

Calca

UniProt Synonym Gene Names

Calc

NCBI Protein Information

calcitonin gene-related peptide 1

NCBI Summary for Calca

This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide (CGRP) and katacalcin. Alternative splicing of the mRNA results in multiple variants that encode either calcitonin or CGRP preproproteins. Post-translational processing of the calcitonin and CGRP propeptides results in either calcitonin and katacalcin, or CGRP, respectively. Calcitonin and katacalcin modulate calcium levels in the blood stream. CGRP can function as a vasodilator and play a role in the transmission of pain. The human homolog of CGRP was found to have antimicrobial activity. [provided by RefSeq, Mar 2015]

UniProt Comments for Calca

Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.

Research Articles on Calca

1. Report a novel positive function of mm9_circ_009056 during osteogenesis in regulating BMP7 through miR-22-3p. Furthermore, the expression of mm9_circ_009056 was up-regulated in CGRP-induced cells, whereas miR-22-3p was decreased.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-Calca antibody

Products by Pathway	Pathway Diagram
Calcitonin-like Ligand Receptors Pathway antibodies	Calcitonin-like Ligand Receptors Pathway Diagram
Class B/2 (Secretin Family Receptors) Pathway antibodies	Class B/2 (Secretin Family Receptors) Pathway Diagram
G Alpha (s) Signalling Events Pathway antibodies	G Alpha (s) Signalling Events Pathway Diagram
GPCR Downstream Signaling Pathway antibodies	GPCR Downstream Signaling Pathway Diagram
GPCR Ligand Binding Pathway antibodies	GPCR Ligand Binding Pathway Diagram
Myometrial Relaxation And Contraction Pathways antibodies	Myometrial Relaxation And Contraction Pathways Diagram
Signal Transduction Pathway antibodies	Signal Transduction Pathway Diagram
Signaling By GPCR Pathway antibodies	Signaling By GPCR Pathway Diagram

Diseases associated with anti-Calca antibody

Disease Name	Pubmed Publications
Inflammation Antibodies	>14 publications with Calca and Inflammation
Lung Diseases Antibodies	>12 publications with Calca and Lung Diseases
Hypertension Antibodies	>6 publications with Calca and Hypertension
Pain Antibodies	>6 publications with Calca and Pain
Migraine Disorders Antibodies	>5 publications with Calca and Migraine Disorders
Headache Antibodies	>5 publications with Calca and Headache
Neurogenic Inflammation Antibodies	>4 publications with Calca and Neurogenic Inflammation
Kidney Diseases Antibodies	>3 publications with Calca and Kidney Diseases
Necrosis Antibodies	>3 publications with Calca and Necrosis
Migraine without Aura Antibodies	>2 publications with Calca and Migraine without Aura

Organs/Tissues associated with anti-Calca antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>23 publications with Calca and Blood
Thyroid Antibodies	>11 publications with Calca and Thyroid
Brain Antibodies	>9 publications with Calca and Brain
Spinal Cord Antibodies	>4 publications with Calca and Spinal Cord
Embryonic Tissue Antibodies	>2 publications with Calca and Embryonic Tissue
Bone Marrow Antibodies	>1 publications with Calca and Bone Marrow