• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CD272 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1751449

Description: Rabbit IgG polyclonal antibody for CD272/BTLA detection. Tested with WB, IHC-P in Human; Mouse.Background: B- and T-lymphocyte attenuator is a protein that in humans is encoded by the BTLA gene. BTLA has also been designated as CD272 (cluster of… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CD272/BTLA, Polyclonal Antibody
Full Product Name
Anti-CD272/BTLA Antibody
Product Gene Name
anti-CD272 antibody
Product Synonym Gene Name
BTLA
Product Synonym Names
B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein; CD272; BTLA; B and T lymphocyte associated
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse
Form/Format
Lyophilized
Purity/Purification
Immunogen Affinity Purified
Specificity
No cross reactivity with other proteins.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Molecular Weight
27,317 Da
3D Structure
ModBase 3D Structure for Q7Z6A9
Immunogen
A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-CD272 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-CD272 antibody
WB: 0.1-0.5 mug/ml
IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.

Western Blot (WB) of anti-CD272 antibody

Figure 1. Western blot analysis of CD272 using anti-CD272 antibody.
CD272/BTLA was detected in paraffin-embedded section of mouse spleen tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CD272/BTLA antibody.
CD272/BTLA was detected in paraffin-embedded section of mouse spleen tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CD272/BTLA antibody.
CD272/BTLA was detected in paraffin-embedded section of human tonsil tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-CD272/BTLA Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Rabbit Anti-CD272 Polyclonal Antibody – Cat# MBS1751449

Product References and Citations for anti-CD272 antibody

1. Watanabe N, Gavrieli M, Sedy JR, Yang J, Fallarino F, Loftin SK, Hurchla MA, Zimmerman N, Sim J, Zang X, Murphy TL, Russell JH, Allison JP, Murphy KM (July 2003). 2. "BTLA is a lymphocyte inhibitory receptor with similarities to CTLA-4 and PD-1". Nature Immunology. 4 (7): 670-9. 3. "Entrez Gene: BTLA B and T lymphocyte associated".

Other Notes

Small volumes of anti-CD272 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CD272 purchase

MBS1751449 is an antibody targeting CD272. Also known as Anti-CD272/BTLA Antibody. Reactive in Human, Mouse. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for CD272. It may not necessarily be applicable to this product.

NCBI GI #
145580619
NCBI GeneID
151888
NCBI Accession #
NP_001078826.1
UniProt Primary Accession #
Q7Z6A9
UniProt Secondary Accession #
Q3B831; Q3HS85; Q6ZNH9
UniProt Related Accession #
Q7Z6A9
GenBank Nucleotide #
NM_001085357.1
NCBI Official Full Name
B- and T-lymphocyte attenuator isoform 2
NCBI Official Synonym Full Names
B and T lymphocyte associated
NCBI Official Symbol
BTLA
NCBI Official Synonym Symbols
BTLA1; CD272
UniProt Protein Name
B- and T-lymphocyte attenuator
UniProt Synonym Protein Names
B- and T-lymphocyte-associated protein; CD_antigen: CD272
UniProt Gene Name
BTLA
NCBI Protein Information
B- and T-lymphocyte attenuator

NCBI Summary for CD272

This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. [provided by RefSeq, Aug 2011]
Show more

UniProt Comments for CD272

Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response.

Research Articles on CD272

1. Data suggest that both HVEM and UL144 bind a common epitope of BTLA, whether engaged in trans or in cis; these studies were conducted in cell lines representing B-lymphocytes, T-lymphocytes, and natural killer cells. (HVEM = human herpes virus entry mediator; UL144 = membrane glycoprotein UL144 of Human herpesvirus 5; BTLA = human B- and T-lymphocyte attenuator)
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-CD272 antibody

 Reference Product  PubMed Publications
 TNFRSF14 antibody  >61 publications with CD272 and TNFRSF14
 PTPN6 antibody  >3 publications with CD272 and PTPN6
 PTPN11 antibody  >3 publications with CD272 and PTPN11

Pathways associated with anti-CD272 antibody

 Products by Pathway  Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Costimulation By The CD28 Family Pathway antibodies  Costimulation By The CD28 Family Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram

Diseases associated with anti-CD272 antibody

 Disease Name  Pubmed Publications
 Necrosis Antibodies  >67 publications with CD272 and Necrosis
 Inflammation Antibodies  >21 publications with CD272 and Inflammation
 Neoplasms Antibodies  >20 publications with CD272 and Neoplasms
 Brain Diseases Antibodies  >7 publications with CD272 and Brain Diseases
 Lymphoma, B-Cell Antibodies  >4 publications with CD272 and Lymphoma, B-Cell
 Learning Disorders Antibodies  >2 publications with CD272 and Learning Disorders
 Skin Neoplasms Antibodies  >2 publications with CD272 and Skin Neoplasms
 Lung Neoplasms Antibodies  >1 publications with CD272 and Lung Neoplasms
 Poisoning Antibodies  >1 publications with CD272 and Poisoning
 Cognition Disorders Antibodies  >1 publications with CD272 and Cognition Disorders

Organs/Tissues associated with anti-CD272 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >118 publications with CD272 and Blood
 Brain Antibodies  >8 publications with CD272 and Brain
 Lymph Node Antibodies  >8 publications with CD272 and Lymph Node
 Thymus Antibodies  >4 publications with CD272 and Thymus
 Kidney Antibodies  >2 publications with CD272 and Kidney
 Pharynx Antibodies  >2 publications with CD272 and Pharynx
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000