Rabbit Anti-PCDH15 Polyclonal Antibody – Cat# MBS1751458

Figure 1. Western blot analysis of PCDH15 using anti-PCDH15 antibody.
PCDH15 was detected in paraffin-embedded section of human prostatic cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PCDH15 antibody.
PCDH15 was detected in paraffin-embedded section of human prostatic cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PCDH15 antibody.
PCDH15 was detected in paraffin-embedded section of human rectal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PCDH15 antibody.
PCDH15 was detected in paraffin-embedded section of human tonsil tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PCDH15 antibody.
PCDH15 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PCDH15 antibody.
PCDH15 was detected in paraffin-embedded section of mouse spleen tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PCDH15 antibody.
PCDH15 was detected in paraffin-embedded section of rat brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PCDH15 antibody.
PCDH15 was detected in paraffin-embedded section of rat spleen tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-PCDH15 Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.

PCDH15 Antibody – Rabbit Polyclonal

Name: PCDH15 Antibody; Polyclonal; Rabbit; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS1751458
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1751458

Description: Rabbit IgG polyclonal antibody for PCDH15 detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: Protocadherin-15 is a protein that in humans is encoded by the PCDH15 gene. This gene is mapped to 10q21.1. This gene is a member of the… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

PCDH15, Polyclonal Antibody

Full Product Name

Anti-PCDH15 Antibody

Product Gene Name

anti-PCDH15 antibody

Product Synonym Names

Protocadherin-15; PCDH15; USH1F; Protocadherin related 15

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human, Mouse, Rat

Form/Format

Lyophilized

Purity/Purification

Immunogen Affinity Purified

Specificity

No cross reactivity with other proteins.

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.

Molecular Weight

92,358 Da

3D Structure

ModBase 3D Structure for Q96QU1

Immunogen

A synthetic peptide corresponding to a sequence of human PCDH15 (DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ).

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Relevant Detection Systems

It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-PCDH15 antibody

Western Blot (WB), Immunohistochemistry (IHC) Paraffin

Application Notes for anti-PCDH15 antibody

WB: 0.1-0.5 mug/ml
IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.

Product References and Citations for anti-PCDH15 antibody

1. Ahmed, Z. M., Riazuddin, S., Ahmad, J., Bernstein, S. L., Guo, Y., Sabar, M. F., Sieving, P., Riazuddin, S., Griffith, A. J., Friedman, T. B., Belyantseva, I. A., Wilcox, E. R. PCDH15 is expressed in the neurosensory epithelium of the eye and ear and mutant alleles are responsible for both USH1F and DFNB23. Hum. Molec. Genet. 12: 3215-3223, 2003. 2. Ahmed, Z. M., Riazuddin, S., Aye, S., Ali, R. A., Venselaar, H., Anwar, S., Belyantseva, P. P., Qasim, M., Riazuddin, S., Friedman, T. B. Gene structure and mutant alleles of PCDH15: nonsyndromic deafness DFNB23 and type 1 Usher syndrome. Hum. Genet. 124: 215-223, 2008. 3. Ahmed, Z. M., Riazuddin, S., Bernstein, S. L., Ahmed, Z., Khan, S., Griffith, A. J., Morell, R. J., Friedman, T. B., Riazuddin, S., Wilcox, E. R. Mutations of the protocadherin gene PCDH15 cause Usher syndrome type 1F. Am. J. Hum. Genet. 69: 25-34, 2001.

Other Notes

Small volumes of anti-PCDH15 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PCDH15 purchase

MBS1751458 is an antibody targeting PCDH15. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for PCDH15. It may not necessarily be applicable to this product.

NCBI GI #

115387123

NCBI GeneID

65217

NCBI Accession #

NP_149045.3

UniProt Primary Accession #

Q96QU1

UniProt Secondary Accession #

Q5VY38; Q5VY39; Q6TRH8; Q8NDB9; Q96QT8; A6NL19; C6ZEF5; C6ZEF6; C6ZEF7

UniProt Related Accession #

Q96QU1

GenBank Nucleotide #

NM_033056.3

NCBI Official Full Name

protocadherin-15 isoform CD1-4

NCBI Official Synonym Full Names

protocadherin related 15

NCBI Official Symbol

PCDH15

NCBI Official Synonym Symbols

USH1F; CDHR15; DFNB23

UniProt Protein Name

Protocadherin-15

Protein Family

Protocadherin

UniProt Gene Name

PCDH15

UniProt Synonym Gene Names

USH1F

NCBI Protein Information

protocadherin-15

NCBI Summary for PCDH15

This gene is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). Extensive alternative splicing resulting in multiple isoforms has been observed in the mouse ortholog. Similar alternatively spliced transcripts are inferred to occur in human, and additional variants are likely to occur. [provided by RefSeq, Dec 2008]

UniProt Comments for PCDH15

Calcium-dependent cell-adhesion protein. Essential for maintenance of normal retinal and cochlear function.

Research Articles on PCDH15

1. Novel 4658delT PCDH15 mutation was identified in a family with nonsyndromic hearing loss.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PCDH15 antibody

Reference Product	PubMed Publications
CDH23 antibody	>64 publications with PCDH15 and CDH23
MYO7A antibody	>33 publications with PCDH15 and MYO7A
USH1C antibody	>33 publications with PCDH15 and USH1C
USH2A antibody	>23 publications with PCDH15 and USH2A
USH1G antibody	>20 publications with PCDH15 and USH1G
GPR98 antibody	>11 publications with PCDH15 and GPR98
DFNB31 antibody	>5 publications with PCDH15 and DFNB31
DFNB59 antibody	>1 publications with PCDH15 and DFNB59
HCN1 antibody	>1 publications with PCDH15 and HCN1

Diseases associated with anti-PCDH15 antibody

Disease Name	Pubmed Publications
Deafness Antibodies	>95 publications with PCDH15 and Deafness
Neurologic Manifestations Antibodies	>84 publications with PCDH15 and Neurologic Manifestations
Usher Syndromes Antibodies	>40 publications with PCDH15 and Usher Syndromes
Disease Models, Animal Antibodies	>12 publications with PCDH15 and Disease Models, Animal
Usher syndrome, type 1F Antibodies	>2 publications with PCDH15 and Usher syndrome, type 1F
Cochlear Diseases Antibodies	>2 publications with PCDH15 and Cochlear Diseases
Heart Diseases Antibodies	>1 publications with PCDH15 and Heart Diseases
Atherosclerosis Antibodies	>1 publications with PCDH15 and Atherosclerosis
Necrosis Antibodies	>1 publications with PCDH15 and Necrosis
Usher syndrome, type 1D Antibodies	>1 publications with PCDH15 and Usher syndrome, type 1D

Organs/Tissues associated with anti-PCDH15 antibody

Organ/Tissue Name	Pubmed Publications
Nerve Antibodies	>21 publications with PCDH15 and Nerve
Eye Antibodies	>19 publications with PCDH15 and Eye
Brain Antibodies	>16 publications with PCDH15 and Brain
Kidney Antibodies	>1 publications with PCDH15 and Kidney