• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MAdCAM1 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1751471

Description: Rabbit IgG polyclonal antibody for MAdCAM1 detection. Tested with WB in Human.Background: MADCAM1 (Mucosal Vascular Addressin Cell Adhesion Molecule 1), also known as MACAM1, is a protein that in humans is encoded by the MADCAM1 gene. By… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MAdCAM1, Polyclonal Antibody
Full Product Name
Anti-MAdCAM1 Antibody
Product Gene Name
anti-MAdCAM1 antibody
Product Synonym Names
Mucosal addressin cell adhesion molecule 1; MAdCAM-1; hMAdCAM-1; MADCAM1; Mucosal vascular addressin cell adhesion molecule 1
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human
Form/Format
Lyophilized
Purity/Purification
Immunogen Affinity Purified
Specificity
No cross reactivity with other proteins.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Molecular Weight
28,705 Da
3D Structure
ModBase 3D Structure for Q13477
Immunogen
A synthetic peptide corresponding to a sequence of human MAdCAM1 (QELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRL).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-MAdCAM1 antibody
Western Blot (WB)
Application Notes for anti-MAdCAM1 antibody
WB: 0.1-0.5 mug/ml
Tested Species: In-house tested species with positive results.

Western Blot (WB) of anti-MAdCAM1 antibody

Figure 1. Western blot analysis of MAdCAM1 using anti-MAdCAM1 antibody.
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human 293T whole cell lysate,
Lane 2: human A375 whole cell lysate,
Lane 3: human K562 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MAdCAM1 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MAdCAM1 at approximately 43KD. The expected band size for MAdCAM1 is at 40KD.
Rabbit Anti-MAdCAM1 Polyclonal Antibody – Cat# MBS1751471

Product References and Citations for anti-MAdCAM1 antibody

1. Briskin, M. J., McEvoy, L. M., Butcher, E. C. MAdCAM-1 has homology to immunoglobulin and mucin-like adhesion receptors and to IgA1. Nature 363: 461-464, 1993. 2. Entrez Gene: mucosal vascular addressin cell adhesion molecule 1. 3. Leung, E., Berg, R. W., Langley, R., Greene, J., Raymond, L. A., Augustus, M., Ni, J., Carter, K. C., Spurr, N., Choo, K. H. A., Krissansen, G. W. Genomic organization, chromosomal mapping, and analysis of the 5-prime promoter region of the human MAdCAM-1 gene. Immunogenetics 46: 111-119, 1997.

Other Notes

Small volumes of anti-MAdCAM1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MAdCAM1 purchase

MBS1751471 is an antibody targeting MAdCAM1. Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for MAdCAM1. It may not necessarily be applicable to this product.

NCBI GI #
109633022
NCBI GeneID
8174
NCBI Accession #
NP_570116.2
UniProt Primary Accession #
Q13477
UniProt Secondary Accession #
O60222; O75867; Q5UGI7; A5PKV4; B2RPL9
UniProt Related Accession #
Q13477
GenBank Nucleotide #
NM_130760.3
NCBI Official Full Name
mucosal addressin cell adhesion molecule 1 isoform a
NCBI Official Synonym Full Names
mucosal vascular addressin cell adhesion molecule 1
NCBI Official Symbol
MADCAM1
NCBI Official Synonym Symbols
MACAM1
UniProt Protein Name
Mucosal addressin cell adhesion molecule 1
Protein Family
Mucosal addressin cell adhesion molecule
UniProt Gene Name
MADCAM1
UniProt Synonym Gene Names
MAdCAM-1; hMAdCAM-1
NCBI Protein Information
mucosal addressin cell adhesion molecule 1

NCBI Summary for MAdCAM1

The protein encoded by this gene is an endothelial cell adhesion molecule that interacts preferentially with the leukocyte beta7 integrin LPAM-1 (alpha4beta7), L-selectin, and VLA-4 (alpha4beta1) on myeloid cells to direct leukocytes into mucosal and inflamed tissues. It is a member of the immunoglobulin family and is similar to ICAM1 and VCAM1. At least seven alternatively spliced transcripts encoding different protein isoforms have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for MAdCAM1

Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
Show more

Research Articles on MAdCAM1

1. Both the ACT-1 assay and the MAdCAM-1 assay demonstrated acceptable reproducibility and repeatability. The assays were sufficiently stable to allow for clinical use. During clinical testing the assays demonstrated that vedolizumab was able to saturate peripheral cells at all doses tested.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MAdCAM1 antibody

 Reference Product  PubMed Publications
 ITGA4 antibody  >47 publications with MAdCAM1 and ITGA4
 CCL25 antibody  >8 publications with MAdCAM1 and CCL25
 CD44 antibody  >5 publications with MAdCAM1 and CD44
 LTBR antibody  >4 publications with MAdCAM1 and LTBR
 NKX2-3 antibody  >3 publications with MAdCAM1 and NKX2-3
 CXCR4 antibody  >2 publications with MAdCAM1 and CXCR4

Pathways associated with anti-MAdCAM1 antibody

 Products by Pathway  Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Cell Adhesion Molecules (CAMs) Pathway antibodies  Cell Adhesion Molecules (CAMs) Pathway Diagram
 Cell Adhesion Molecules (CAMs) Pathway antibodies  Cell Adhesion Molecules (CAMs) Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway antibodies  Immunoregulatory Interactions Between A Lymphoid And A Non-Lymphoid Cell Pathway Diagram
 Integrin Cell Surface Interactions Pathway antibodies  Integrin Cell Surface Interactions Pathway Diagram
 Intestinal Immune Network For IgA Production Pathway antibodies  Intestinal Immune Network For IgA Production Pathway Diagram
 Intestinal Immune Network For IgA Production Pathway antibodies  Intestinal Immune Network For IgA Production Pathway Diagram
 Paxillin-independent Events Mediated By A4b1 And A4b7 Pathway antibodies  Paxillin-independent Events Mediated By A4b1 And A4b7 Pathway Diagram
 Signal Transduction Pathway antibodies  Signal Transduction Pathway Diagram

Diseases associated with anti-MAdCAM1 antibody

 Disease Name  Pubmed Publications
 Inflammation Antibodies  >81 publications with MAdCAM1 and Inflammation
 Necrosis Antibodies  >46 publications with MAdCAM1 and Necrosis
 Colitis Antibodies  >45 publications with MAdCAM1 and Colitis
 Inflammatory Bowel Diseases Antibodies  >36 publications with MAdCAM1 and Inflammatory Bowel Diseases
 Vascular Diseases Antibodies  >31 publications with MAdCAM1 and Vascular Diseases
 Lymphoma Antibodies  >28 publications with MAdCAM1 and Lymphoma
 Autoimmune Diseases Antibodies  >25 publications with MAdCAM1 and Autoimmune Diseases
 Liver Diseases Antibodies  >13 publications with MAdCAM1 and Liver Diseases
 Weight Loss Antibodies  >5 publications with MAdCAM1 and Weight Loss
 Pancreatitis Antibodies  >3 publications with MAdCAM1 and Pancreatitis

Organs/Tissues associated with anti-MAdCAM1 antibody

 Organ/Tissue Name  Pubmed Publications
 Spleen Antibodies  >46 publications with MAdCAM1 and Spleen
 Brain Antibodies  >13 publications with MAdCAM1 and Brain
 Heart Antibodies  >5 publications with MAdCAM1 and Heart
 Testis Antibodies  >1 publications with MAdCAM1 and Testis
 Eye Antibodies  >1 publications with MAdCAM1 and Eye
 Thyroid Antibodies  >1 publications with MAdCAM1 and Thyroid
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000