• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GPCR LGR8/RXFP2 (RXFP2) Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1751480

Description: Rabbit IgG polyclonal antibody for GPCR LGR8 detection. Tested with WB, IHC-F, ICC, FCM in Human.Background: Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GPCR LGR8/RXFP2, Polyclonal Antibody
Full Product Name
Anti-GPCR LGR8/RXFP2 Antibody
Product Gene Name
anti-RXFP2 antibody
Product Synonym Names
Relaxin receptor 2; G-protein coupled receptor 106; G-protein coupled receptor affecting testicular descent; Leucine-rich repeat-containing G-protein coupled receptor 8; Relaxin family peptide receptor 2; RXFP2; GPR106; GREAT; LGR8; Relaxin family peptide receptor 2
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human
Form/Format
Lyophilized
Purity/Purification
Immunogen Affinity Purified
Specificity
No cross reactivity with other proteins.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Molecular Weight
83,736 Da
3D Structure
ModBase 3D Structure for Q8WXD0
Immunogen
A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-F and ICC.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-RXFP2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Frozen, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS)
Application Notes for anti-RXFP2 antibody
WB: 0.1-0.5 mug/ml
IHC-F: 0.5-1 mug/ml
ICC: 0.5-1 mug/ml
FC/FACS: 1-3ug/1x106 cells
Tested Species: In-house tested species with positive results.

Western Blot (WB) of anti-RXFP2 antibody

Figure 1. Western blot analysis of GPCR LGR8 using anti-GPCR LGR8 antibody.
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human SHG-44 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GPCR LGR8 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GPCR LGR8 at approximately 86KD. The expected band size for GPCR LGR8 is at 86KD.
Rabbit Anti-RXFP2 Polyclonal Antibody – Cat# MBS1751480

Product References and Citations for anti-RXFP2 antibody

1. Ars, E., Lo Giacco, D., Bassas, L., Nuti, F., Rajmil, O., Ruiz, P., Garat, J. M., Ruiz-Castane, E., Krausz, C. Further insights into the role of T222P variant of RXFP2 in non-syndromic cryptorchidism in two Mediterranean populations. Int. J. Androl. 34: 333-338, 2010. 2. Ferlin, A., Simonato, M., Bartoloni, L., Rizzo, G., Bettella, A., Dottorini, T., Dallapiccola, B., Foresta, C. The INSL3-LGR8/GREAT ligand-receptor pair in human cryptorchidism. J. Clin. Endocr. Metab. 88: 4273-4279, 2003. 3. Harris, R. M., Finlayson, C., Weiss, J., Fisher, L., Hurley, L., Barrett, T., Emge, D., Bathgate, R. A. D., Agoulnik, A. I., Jameson, J. L. A missense mutation in LRR8 of RXFP2 is associated with cryptorchidism. Mammalian Genome 21: 442-449, 2010.

Other Notes

Small volumes of anti-RXFP2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RXFP2 purchase

MBS1751480 is an antibody targeting RXFP2. Also known as Anti-GPCR LGR8/RXFP2 Antibody. Reactive in Human. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for RXFP2. It may not necessarily be applicable to this product.

NCBI GI #
260593673
NCBI GeneID
122042
NCBI Accession #
NP_001159530.1
UniProt Primary Accession #
Q8WXD0
UniProt Secondary Accession #
Q3KU23; B1ALE9
UniProt Related Accession #
Q8WXD0
GenBank Nucleotide #
NM_001166058.1
NCBI Official Full Name
relaxin receptor 2 isoform 2
NCBI Official Synonym Full Names
relaxin family peptide receptor 2
NCBI Official Symbol
RXFP2
NCBI Official Synonym Symbols
LGR8; GREAT; GPR106; INSL3R; LGR8.1; RXFPR2
UniProt Protein Name
Relaxin receptor 2
UniProt Synonym Protein Names
G-protein coupled receptor 106; G-protein coupled receptor affecting testicular descent; Leucine-rich repeat-containing G-protein coupled receptor 8; Relaxin family peptide receptor 2
Protein Family
Relaxin receptor
UniProt Gene Name
RXFP2
UniProt Synonym Gene Names
GPR106; GREAT; LGR8
NCBI Protein Information
relaxin receptor 2

NCBI Summary for RXFP2

This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]

UniProt Comments for RXFP2

Receptor for relaxin. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. May also be a receptor for Leydig insulin-like peptide (INSL3).CautionIt is uncertain whether Met-1 or Met-18 is the initiator.

Research Articles on RXFP2

1. In the TMD discovery cohort, sex-stratified analysis identified 2 additional genome-wide significant loci in females. One lying upstream of the relaxin/insulin-like family peptide receptor 2 ( RXP2) (chromosome 13, rs60249166,[OR] = 0.65, P = 3.6 x 10(-8)) was replicated among females in the meta-analysis (1-tailed P = 0.052). The other (chromosome 17, rs1531554, OR = 0.68, P = 2.9 x 10(-8)) was replicated among f
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RXFP2 antibody

 Reference Product  PubMed Publications
 INSL3 antibody  >79 publications with RXFP2 and INSL3
 RLN2 antibody  >11 publications with RXFP2 and RLN2

Pathways associated with anti-RXFP2 antibody

 Products by Pathway  Pathway Diagram
 Class A/1 (Rhodopsin-like Receptors) Pathway antibodies  Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
 G Alpha (s) Signalling Events Pathway antibodies  G Alpha (s) Signalling Events Pathway Diagram
 GPCR Downstream Signaling Pathway antibodies  GPCR Downstream Signaling Pathway Diagram
 GPCR Ligand Binding Pathway antibodies  GPCR Ligand Binding Pathway Diagram
 Myometrial Relaxation And Contraction Pathways antibodies  Myometrial Relaxation And Contraction Pathways Diagram
 Neuroactive Ligand-receptor Interaction Pathway antibodies  Neuroactive Ligand-receptor Interaction Pathway Diagram
 Neuroactive Ligand-receptor Interaction Pathway antibodies  Neuroactive Ligand-receptor Interaction Pathway Diagram
 Peptide Ligand-binding Receptors Pathway antibodies  Peptide Ligand-binding Receptors Pathway Diagram
 Relaxin Receptors Pathway antibodies  Relaxin Receptors Pathway Diagram
 Signal Transduction Pathway antibodies  Signal Transduction Pathway Diagram

Diseases associated with anti-RXFP2 antibody

 Disease Name  Pubmed Publications
 Cryptorchidism Antibodies  >35 publications with RXFP2 and Cryptorchidism
 Fibrosis Antibodies  >6 publications with RXFP2 and Fibrosis
 Pregnancy Complications Antibodies  >3 publications with RXFP2 and Pregnancy Complications
 Cardiovascular Diseases Antibodies  >2 publications with RXFP2 and Cardiovascular Diseases
 Thyroid Neoplasms Antibodies  >2 publications with RXFP2 and Thyroid Neoplasms
 Prenatal Exposure Delayed Effects Antibodies  >2 publications with RXFP2 and Prenatal Exposure Delayed Effects
 Weight Loss Antibodies  >1 publications with RXFP2 and Weight Loss
 Carcinoma, Hepatocellular Antibodies  >1 publications with RXFP2 and Carcinoma, Hepatocellular
 Hyperplasia Antibodies  >1 publications with RXFP2 and Hyperplasia
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000