• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Doppel/PRND (PRND) Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1751490

Description: Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: Prion protein 2 (dublet), also known as PRND, or Doppel protein, is a protein which in humans is encoded by the PRND gene. It is mapped to… More details

DISCONTINUED
Click here to view our similar product(s) OR click here to contact our technical support team for suitable replacement.
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Product Name
Doppel/PRND, Polyclonal Antibody
Full Product Name
Anti-Doppel/PRND Antibody
Product Gene Name
anti-PRND antibody
Product Synonym Names
Prion-like protein doppel; PrPLP; Prion protein 2; PRND; DPL; UNQ1830/PRO3443; Prion like protein doppel
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized
Purity/Purification
Immunogen Affinity Purified
Specificity
No cross reactivity with other proteins.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Molecular Weight
20,293 Da
3D Structure
ModBase 3D Structure for Q9UKY0
Immunogen
A synthetic peptide corresponding to a sequence of human Doppel (ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-PRND antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-PRND antibody
WB: 0.1-0.5 mug/ml
IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.

Western Blot (WB) of anti-PRND antibody

Figure 1. Western blot analysis of Doppel using anti-Doppel antibody.
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human SHG-44 whole cell lysate,
Lane 2: rat testis tissue lysates,
Lane 3: rat kidney tissue lysates,
Lane 4: mouse testis tissue lysates,
Lane 5: mouse kidney tissue lysates,
Lane 6: mouse brain tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Doppel antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Doppel at approximately 23KD. The expected band size for Doppel is at 20KD.
Rabbit Anti-PRND Polyclonal Antibody – Cat# MBS1751490

Immunohistochemistry (IHC) of anti-PRND antibody

Figure 3. IHC analysis of Doppel using anti-Doppel antibody.
Doppel was detected in paraffin-embedded section of human testis tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-Doppel antibody.
Doppel was detected in paraffin-embedded section of human testis tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-Doppel Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Rabbit Anti-PRND Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS1751490

Product References and Citations for anti-PRND antibody

1. Comincini, S., Foti, M. G., Tranulis, M. A., Hills, D., Di Guardo, G., Vaccari, G., Williams, J. L., Harbitz, I., Ferretti, L. Genomic organization, comparative analysis, and genetic polymorphisms of the bovine and ovine prion Doppel genes (PRND). Mammalian Genome 12: 729-733, 2001. 2. Croes, E. A., Alizadeh, B. Z., Bertoli-Avella, A. M., Rademaker, T., Vergeer-Drop, J., Dermaut, B., Houwing-Duistermaat, J. J., Wientjens, D. P. W. M., Hofman, A., Van Broeckhoven, C., van Duijn, C. M. Polymorphisms in the prion protein gene and in the doppel gene increase susceptibility for Creutzfeldt-Jakob disease. Europ. J. Hum. Genet. 12: 389-394, 2004. 3. Genoud, N., Behrens, A., Miele, G., Robay, D., Heppner, F. L., Freigang, S., Aguzzi, A.Disruption of Doppel prevents neurodegeneration in mice with extensive Prnp deletions.Proc. Nat. Acad. Sci. 101: 4198-4203, 2004.

Other Notes

Small volumes of anti-PRND antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PRND purchase

MBS1751490 is an antibody targeting PRND. Also known as Anti-Doppel/PRND Antibody. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for PRND. It may not necessarily be applicable to this product.

NCBI GI #
34335268
NCBI GeneID
23627
NCBI Accession #
NP_036541.2
UniProt Primary Accession #
Q9UKY0
UniProt Secondary Accession #
Q9H311; Q9H312; Q9NTM4; A7U7M5
UniProt Related Accession #
Q9UKY0
GenBank Nucleotide #
NM_012409.4
NCBI Official Full Name
prion-like protein doppel preproprotein
NCBI Official Synonym Full Names
prion like protein doppel
NCBI Official Symbol
PRND
NCBI Official Synonym Symbols
DPL; PrPLP; DOPPEL; dJ1068H6.4
UniProt Protein Name
Prion-like protein doppel
UniProt Synonym Protein Names
PrPLP; Prion protein 2
Protein Family
Aminopyrrolnitrin oxygenase
UniProt Gene Name
PRND
UniProt Synonym Gene Names
DPL
NCBI Protein Information
prion-like protein doppel

NCBI Summary for PRND

This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for PRND

Required for normal acrosome reaction and for normal male fertility (). Can bind Cu2+ (PubMed:15218028, PubMed:20411530).

Research Articles on PRND

1. results demonstrate that blocking doppel can control VEGF signaling in TECs and selectively inhibit tumor angiogenesis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PRND antibody

 Reference Product  PubMed Publications
 GNB2L1 antibody  >1 publications with PRND and GNB2L1

Diseases associated with anti-PRND antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >75 publications with PRND and Nervous System Diseases
 Nerve Degeneration Antibodies  >14 publications with PRND and Nerve Degeneration
 Disease Models, Animal Antibodies  >4 publications with PRND and Disease Models, Animal
 Inflammation Antibodies  >3 publications with PRND and Inflammation
 Heart Diseases Antibodies  >2 publications with PRND and Heart Diseases
 Mitochondrial Diseases Antibodies  >1 publications with PRND and Mitochondrial Diseases
 Atrophy Antibodies  >1 publications with PRND and Atrophy
 Adenocarcinoma Antibodies  >1 publications with PRND and Adenocarcinoma
 Kidney Diseases Antibodies  >1 publications with PRND and Kidney Diseases
 Learning Disorders Antibodies  >1 publications with PRND and Learning Disorders

Organs/Tissues associated with anti-PRND antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >61 publications with PRND and Brain
 Testis Antibodies  >32 publications with PRND and Testis
 Heart Antibodies  >3 publications with PRND and Heart
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000