• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ELAVL2 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1751501

Description: Rabbit IgG polyclonal antibody for ELAVL2 HuB detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: ELAV-like protein 2 is a protein that in humans is encoded by the ELAVL2 gene. This gene encodes a member of the cytochrome P450… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ELAVL2 HuB, Polyclonal Antibody
Full Product Name
Anti-ELAVL2 HuB Antibody
Product Gene Name
anti-ELAVL2 antibody
Product Synonym Names
ELAV-like protein 2; ELAV-like neuronal protein 1; Hu-antigen B; HuB; Nervous system-specific RNA-binding protein Hel-N1; ELAVL2; HUB; ELAV like RNA binding protein 2
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized
Purity/Purification
Immunogen Affinity Purified
Specificity
No cross reactivity with other proteins.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Molecular Weight
38,015 Da
3D Structure
ModBase 3D Structure for Q12926
Immunogen
A synthetic peptide corresponding to a sequence of human ELAVL2 HuB (METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSK).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-ELAVL2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-ELAVL2 antibody
WB: 0.1-0.5 mug/ml
IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.

Western Blot (WB) of anti-ELAVL2 antibody

Figure 1. Western blot analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human T-47D whole cell lysate,
Lane 2: human A549 whole cell lysate,
Lane 3: human Caco-2 whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ELAVL2 HuB antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ELAVL2 HuB at approximately 45KD. The expected band size for ELAVL2 HuB is at 40KD.
Rabbit Anti-ELAVL2 Polyclonal Antibody – Cat# MBS1751501

Immunohistochemistry (IHC) of anti-ELAVL2 antibody

Figure 3. IHC analysis of ELAVL2 HuB using anti-ELAVL2 HuB antibody.
ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB antibody.
ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB antibody.
ELAVL2 HuB was detected in paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB antibody.
ELAVL2 HuB was detected in paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ELAVL2 HuB Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Rabbit Anti-ELAVL2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS1751501

Product References and Citations for anti-ELAVL2 antibody

1. Guyant-Marechal, L., Verrips, A., Girard, C., Wevers, R. A., Zijlstra, F., Sistermans, E., Vera, P., Campion, D., Hannequin, D. Unusual cerebrotendinous xanthomatosis with fronto-temporal dementia phenotype. Am. J. Med. Genet. 139A: 114-117, 2005. 2. Lamon-Fava, S., Schaefer, E. J., Garuti, R., Salen, G., Calandra, S. Two novel mutations in the sterol 27-hydroxylase gene causing cerebrotendinous xanthomatosis. Clin. Genet. 61: 185-191, 2002.

Other Notes

Small volumes of anti-ELAVL2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ELAVL2 purchase

MBS1751501 is an antibody targeting ELAVL2. Also known as Anti-ELAVL2 HuB Antibody. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for ELAVL2. It may not necessarily be applicable to this product.

NCBI GI #
283945529
NCBI GeneID
1993
NCBI Accession #
NP_001164666.1
UniProt Primary Accession #
Q12926
UniProt Secondary Accession #
Q13235; Q59G15; Q8NEM4; Q9H1Q8; D3DRK3
UniProt Related Accession #
Q12926
GenBank Nucleotide #
NM_001171195.1
NCBI Official Full Name
ELAV-like protein 2 isoform b
NCBI Official Synonym Full Names
ELAV like RNA binding protein 2
NCBI Official Symbol
ELAVL2
NCBI Official Synonym Symbols
HUB; HELN1; HEL-N1
UniProt Protein Name
ELAV-like protein 2
UniProt Synonym Protein Names
ELAV-like neuronal protein 1; Hu-antigen B; HuB; Nervous system-specific RNA-binding protein Hel-N1
Protein Family
ELAV-like protein
UniProt Gene Name
ELAVL2
UniProt Synonym Gene Names
HUB; HuB
NCBI Protein Information
ELAV-like protein 2

NCBI Summary for ELAVL2

The protein encoded by this gene is a neural-specific RNA-binding protein that is known to bind to several 3' UTRs, including its own and also that of FOS and ID. The encoded protein may recognize a GAAA motif in the RNA. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]
Show more

UniProt Comments for ELAVL2

Binds RNA. Seems to recognize a GAAA motif. Can bind to its own 3'-UTR, the FOS 3'-UTR and the ID 3'-UTR.

Research Articles on ELAVL2

1. ELAVL2-regulated co-expression networks are also enriched for neurodevelopmental and synaptic genes, and include genes with human-specific patterns of expression in the frontal pole. Together, these data suggest that ELAVL2 regulation of transcript expression is critical for neuronal function and clinically relevant to autism
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ELAVL2 antibody

 Reference Product  PubMed Publications
 ELAVL4 antibody  >7 publications with ELAVL2 and ELAVL4
 ELAVL3 antibody  >6 publications with ELAVL2 and ELAVL3

Diseases associated with anti-ELAVL2 antibody

 Disease Name  Pubmed Publications
 Carcinoma Antibodies  >9 publications with ELAVL2 and Carcinoma
 Small Cell Lung Carcinoma Antibodies  >7 publications with ELAVL2 and Small Cell Lung Carcinoma
 Neoplasm Metastasis Antibodies  >1 publications with ELAVL2 and Neoplasm Metastasis
 Immune System Diseases Antibodies  >1 publications with ELAVL2 and Immune System Diseases
 Liver Neoplasms Antibodies  >1 publications with ELAVL2 and Liver Neoplasms
 Breast Neoplasms Antibodies  >1 publications with ELAVL2 and Breast Neoplasms
 Necrosis Antibodies  >1 publications with ELAVL2 and Necrosis

Organs/Tissues associated with anti-ELAVL2 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >15 publications with ELAVL2 and Brain
 Embryonic Tissue Antibodies  >13 publications with ELAVL2 and Embryonic Tissue
 Eye Antibodies  >1 publications with ELAVL2 and Eye
 Testis Antibodies  >1 publications with ELAVL2 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000