• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SHP2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1751917

Description: Mouse IgG monoclonal antibody for SHP2/PTPN11 detection. Tested with WB, IHC-P, IHC-F, ICC/IF in Human; Mouse; Rat.Background: PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D),… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SHP2/PTPN11, Monoclonal Antibody
Full Product Name
Anti-SHP2/PTPN11 Antibody (monoclonal, 2E6)
Product Gene Name
anti-SHP2 antibody
Product Synonym Gene Name
PTPN11
Product Synonym Names
Tyrosine-protein phosphatase non-receptor type 11; Protein-tyrosine phosphatase 1D; PTP-1D; Protein-tyrosine phosphatase 2C; PTP-2C; SH-PTP2; SHP-2; Shp2; SH-PTP3; PTPN11; PTP2C; SHPTP2; Protein tyrosine phosphatase, non-receptor type 11
Clonality
Monoclonal
Isotype
IgG2b
Clone Number
2E6
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized; Each vial contains 4mg Trehalose, 0.9mg NaCI, 0.2mg Na2HPO4, 0.05mg NaN3
Purity/Purification
Immunogen Affinity Purified
Specificity
No cross reactivity with other proteins.
Preparation and Storage
Store at -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.
Avoid repeated freezing and thawing.
3D Structure
ModBase 3D Structure for Q06124
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG MBS176460 for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit MBS176453 for IHC-P and ICC.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-SHP2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Frozen/Paraffin, Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry
Application Notes for anti-SHP2 antibody
WB: 0.1-0.5ug/ml
IHC-P: 0.5-1ug/ml; Antigen Retrieval: By heat
IHC-F: 0.5-1ug/ml
ICC/IF: 2ug/ml
FC: 1-3ug/1x106 cells
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.

Other applications have bot been tested.
Optimal dilutions should be determined by end users.

Product References and Citations for anti-SHP2 antibody

1. Higashi, H., Tsutsumi, R., Muto, S., Sugiyama, T., Azuma, T, Asaka, M., Hatakeyama, M. SHP-2 tyrosine phosphatase as an intracellular target of Helicobacter pylori CagA protein. Science 295: 683-686, 2002.

Other Notes

Small volumes of anti-SHP2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SHP2 purchase

MBS1751917 is an antibody targeting SHP2. Also known as Anti-SHP2/PTPN11 Antibody (monoclonal, 2E6). Reactive in Human, Mouse, Rat. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SHP2. It may not necessarily be applicable to this product.

NCBI GI #
1059433492
NCBI GeneID
5781
NCBI Accession #
NP_001317366.1
UniProt Primary Accession #
Q06124
UniProt Secondary Accession #
Q96HD7; A8K1D9
UniProt Related Accession #
Q06124
GenBank Nucleotide #
NM_001330437.1
NCBI Official Full Name
tyrosine-protein phosphatase non-receptor type 11 isoform 3
NCBI Official Synonym Full Names
protein tyrosine phosphatase, non-receptor type 11
NCBI Official Symbol
PTPN11
NCBI Official Synonym Symbols
CFC; NS1; JMML; SHP2; BPTP3; PTP2C; METCDS; PTP-1D; SH-PTP2; SH-PTP3
UniProt Protein Name
Tyrosine-protein phosphatase non-receptor type 11
UniProt Synonym Protein Names
Protein-tyrosine phosphatase 1D; PTP-1D; Protein-tyrosine phosphatase 2C; PTP-2C; SH-PTP2; SHP-2; Shp2; SH-PTP3
UniProt Gene Name
PTPN11
UniProt Synonym Gene Names
PTP2C; SHPTP2; PTP-1D; PTP-2C; SHP-2; Shp2
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 11

NCBI Summary for SHP2

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia. [provided by RefSeq, Aug 2016]
Show more

UniProt Comments for SHP2

Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to participate in the signal transduction from the cell surface to the nucleus. Positively regulates MAPK signal transduction pathway (PubMed:28074573). Dephosphorylates GAB1, ARHGAP35 and EGFR (PubMed:28074573). Dephosphorylates ROCK2 at 'Tyr-722' resulting in stimulatation of its RhoA binding activity. Dephosphorylates CDC73 (PubMed:26742426).
Show more

Research Articles on SHP2

1. Authors identify that miR-186 serves as a tumor suppressor in OSCC. Downregulation of this microRNA may lead to a higher expression of oncogenic factor SHP2, which leads to activation of growth promoting signaling.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SHP2 antibody

 Reference Product  PubMed Publications
 GRB2 antibody  >144 publications with SHP2 and GRB2
 JAK2 antibody  >98 publications with SHP2 and JAK2
 GAB1 antibody  >76 publications with SHP2 and GAB1
 GAB2 antibody  >45 publications with SHP2 and GAB2
 IRS1 antibody  >41 publications with SHP2 and IRS1
 JAK1 antibody  >39 publications with SHP2 and JAK1
 EGFR antibody  >39 publications with SHP2 and EGFR
 PDGFRB antibody  >23 publications with SHP2 and PDGFRB
 FRS2 antibody  >15 publications with SHP2 and FRS2
 PXN antibody  >14 publications with SHP2 and PXN

Pathways associated with anti-SHP2 antibody

 Products by Pathway  Pathway Diagram
 Activated TLR4 Signalling Pathway antibodies  Activated TLR4 Signalling Pathway Diagram
 Activation Of IRF3/IRF7 Mediated By TBK1/IKK Epsilon Pathway antibodies  Activation Of IRF3/IRF7 Mediated By TBK1/IKK Epsilon Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Adipocytokine Signaling Pathway antibodies  Adipocytokine Signaling Pathway Diagram
 Adipocytokine Signaling Pathway antibodies  Adipocytokine Signaling Pathway Diagram
 Alpha 6 Beta 4 Signaling Pathway antibodies  Alpha 6 Beta 4 Signaling Pathway Diagram
 Angiopoietin Receptor Tie2-mediated Signaling Pathway antibodies  Angiopoietin Receptor Tie2-mediated Signaling Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram

Diseases associated with anti-SHP2 antibody

 Disease Name  Pubmed Publications
 Noonan Syndrome Antibodies  >410 publications with SHP2 and Noonan Syndrome
 Heart Diseases Antibodies  >392 publications with SHP2 and Heart Diseases
 Leukemia Antibodies  >309 publications with SHP2 and Leukemia
 LEOPARD Syndrome Antibodies  >137 publications with SHP2 and LEOPARD Syndrome
 Leukemia, Myelomonocytic, Juvenile Antibodies  >112 publications with SHP2 and Leukemia, Myelomonocytic, Juvenile
 Carcinoma Antibodies  >86 publications with SHP2 and Carcinoma
 Inflammation Antibodies  >67 publications with SHP2 and Inflammation
 Cell Transformation, Neoplastic Antibodies  >57 publications with SHP2 and Cell Transformation, Neoplastic
 Costello Syndrome Antibodies  >49 publications with SHP2 and Costello Syndrome
 Adenocarcinoma Antibodies  >44 publications with SHP2 and Adenocarcinoma

Organs/Tissues associated with anti-SHP2 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >411 publications with SHP2 and Blood
 Heart Antibodies  >187 publications with SHP2 and Heart
 Bone Antibodies  >144 publications with SHP2 and Bone
 Bone Marrow Antibodies  >112 publications with SHP2 and Bone Marrow
 Muscle Antibodies  >92 publications with SHP2 and Muscle
 Brain Antibodies  >88 publications with SHP2 and Brain
 Liver Antibodies  >70 publications with SHP2 and Liver
 Skin Antibodies  >66 publications with SHP2 and Skin
 Stomach Antibodies  >50 publications with SHP2 and Stomach
 Nerve Antibodies  >49 publications with SHP2 and Nerve
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000