• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CCT3 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1752369

Description: Mouse IgG monoclonal antibody for CCT3 detection. Tested with WB in Human.Background: T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CCT3, Monoclonal Antibody
Full Product Name
Anti-CCT3 Antibody (monoclonal, 12H4)
Product Gene Name
anti-CCT3 antibody
Product Synonym Names
T-complex protein 1 subunit gamma; TCP-1-gamma; CCT-gamma; hTRiC5; CCT3; CCTG; TRIC5; Chaperonin containing TCP1 subunit 3
Clonality
Monoclonal
Isotype
IgG1
Clone Number
12H4
Host
Mouse
Species Reactivity
Human
Form/Format
Lyophilized
Purity/Purification
Immunogen Affinity Purified
Specificity
No cross reactivity with other proteins.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Molecular Weight
56,431 Da
3D Structure
ModBase 3D Structure for P49368
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-CCT3 antibody
Western Blot (WB)
Application Notes for anti-CCT3 antibody
WB: 0.1-0.5 mug/ml
Tested Species: In-house tested species with positive results.

Western Blot (WB) of anti-CCT3 antibody

Figure 1. Western blot analysis of CCT3 using anti-CCT3 antibody (M05920).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human MCF-7 whole cell lysates,
Lane 3: human COLO-320 whole cell lysates,
Lane 4: human HepG2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-CCT3 antigen affinity purified monoclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a Biotin Conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
Mouse Anti-CCT3 Monoclonal Antibody – Cat# MBS1752369

Product References and Citations for anti-CCT3 antibody

1. "Entrez Gene: CCT3 chaperonin containing TCP1, subunit 3 (gamma)". 2. Joly EC, Sévigny G, Todorov IT, Bibor-Hardy V (Mar 1994). "cDNA encoding a novel TCP1-related protein".Biochimica et Biophysica Acta 1217 (2): 224-6. 3. Walkley NA, Demaine AG, Malik AN (Jan 1996)."Cloning, structure and mRNA expression of human Cctg, which encodes the chaperonin subunit CCT gamma". The Biochemical Journal 313 (Pt 2): 381-9.

Other Notes

Small volumes of anti-CCT3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CCT3 purchase

MBS1752369 is an antibody targeting CCT3. Also known as Anti-CCT3 Antibody (monoclonal, 12H4). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CCT3. It may not necessarily be applicable to this product.

NCBI GI #
58761484
NCBI GeneID
7203
NCBI Accession #
NP_001008800.1
UniProt Primary Accession #
P49368
UniProt Secondary Accession #
Q5SZY1; Q9BR64; A6NE14
UniProt Related Accession #
P49368
GenBank Nucleotide #
NM_001008800.2
NCBI Official Full Name
T-complex protein 1 subunit gamma isoform c
NCBI Official Synonym Full Names
chaperonin containing TCP1 subunit 3
NCBI Official Symbol
CCT3
NCBI Official Synonym Symbols
CCTG; PIG48; TRIC5; CCT-gamma; TCP-1-gamma
UniProt Protein Name
T-complex protein 1 subunit gamma
UniProt Synonym Protein Names
CCT-gamma; hTRiC5
Protein Family
Thermosome
UniProt Gene Name
CCT3
UniProt Synonym Gene Names
CCTG; TRIC5; TCP-1-gamma
NCBI Protein Information
T-complex protein 1 subunit gamma

NCBI Summary for CCT3

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8. [provided by RefSeq, Aug 2010]
Show more

UniProt Comments for CCT3

Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of proteins upon ATP hydrolysis (PubMed:25467444). The TRiC complex mediates the folding of WRAP53/TCAB1, thereby regulating telomere maintenance (PubMed:25467444). As part of the TRiC complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia (PubMed:20080638). The TRiC complex plays a role in the folding of actin and tubulin (Probable).
Show more

Research Articles on CCT3

1. Suggest that CCT3 is indispensible for hepatocellular carcinoma cell proliferation, and provides a potential drug target for treatment of HCC.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CCT3 antibody

 Products by Pathway  Pathway Diagram
 Assembly Of The Primary Cilium Pathway antibodies  Assembly Of The Primary Cilium Pathway Diagram
 Association Of TriC/CCT With Target Proteins During Biosynthesis Pathway antibodies  Association Of TriC/CCT With Target Proteins During Biosynthesis Pathway Diagram
 BBSome-mediated Cargo-targeting To Cilium Pathway antibodies  BBSome-mediated Cargo-targeting To Cilium Pathway Diagram
 Cargo Trafficking To The Periciliary Membrane Pathway antibodies  Cargo Trafficking To The Periciliary Membrane Pathway Diagram
 Chaperonin-mediated Protein Folding Pathway antibodies  Chaperonin-mediated Protein Folding Pathway Diagram
 Cooperation Of PDCL (PhLP1) And TRiC/CCT In G-protein Beta Folding Pathway antibodies  Cooperation Of PDCL (PhLP1) And TRiC/CCT In G-protein Beta Folding Pathway Diagram
 Cooperation Of Prefoldin And TriC/CCT In Actin And Tubulin Folding Pathway antibodies  Cooperation Of Prefoldin And TriC/CCT In Actin And Tubulin Folding Pathway Diagram
 Folding Of Actin By CCT/TriC Pathway antibodies  Folding Of Actin By CCT/TriC Pathway Diagram
 Formation Of Tubulin Folding Intermediates By CCT/TriC Pathway antibodies  Formation Of Tubulin Folding Intermediates By CCT/TriC Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram

Diseases associated with anti-CCT3 antibody

 Disease Name  Pubmed Publications
 Carcinoma Antibodies  >9 publications with CCT3 and Carcinoma
 Carcinoma, Hepatocellular Antibodies  >7 publications with CCT3 and Carcinoma, Hepatocellular
 Adenocarcinoma Antibodies  >6 publications with CCT3 and Adenocarcinoma
 Liver Neoplasms Antibodies  >6 publications with CCT3 and Liver Neoplasms
 Liver Diseases Antibodies  >5 publications with CCT3 and Liver Diseases
 Neoplasm Metastasis Antibodies  >1 publications with CCT3 and Neoplasm Metastasis
 Kidney Diseases Antibodies  >1 publications with CCT3 and Kidney Diseases
 Adenoma, Liver Cell Antibodies  >1 publications with CCT3 and Adenoma, Liver Cell
 Neoplasms, Experimental Antibodies  >1 publications with CCT3 and Neoplasms, Experimental
 Abnormalities, Drug-Induced Antibodies  >1 publications with CCT3 and Abnormalities, Drug-Induced

Organs/Tissues associated with anti-CCT3 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >6 publications with CCT3 and Liver
 Blood Antibodies  >4 publications with CCT3 and Blood
 Kidney Antibodies  >2 publications with CCT3 and Kidney
 Brain Antibodies  >2 publications with CCT3 and Brain
 Bone Antibodies  >1 publications with CCT3 and Bone
 Muscle Antibodies  >1 publications with CCT3 and Muscle
 Ovary Antibodies  >1 publications with CCT3 and Ovary
 Eye Antibodies  >1 publications with CCT3 and Eye
 Lung Antibodies  >1 publications with CCT3 and Lung
 Testis Antibodies  >1 publications with CCT3 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000