Anti-IGFBP5 Polyclonal Antibody – Cat# MBS177651

Anti- IGFBP5 Picoband antibody, MBS177651, Western blotting
All lanes: Anti IGFBP5 (MBS177651) at 0.5ug/ml
Lane 1: U20S Whole Cell Lysate at 40ug
Lane 2: HELA Whole Cell Lysate at 40ug
Predicted bind size: 31KD
Observed bind size: 23KD

IGFBP5 Antibody – Polyclonal

Name: IGFBP5 Antibody; Polyclonal; Human-Reactive; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS177651
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177651

Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 5(IGFBP5) detection. Tested with WB, ELISA in Human.Background: Insulin-like growth factor-binding protein 5 is a protein that in humans is encoded by… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

IGFBP5, Polyclonal Antibody

Full Product Name

Anti-IGFBP5 Antibody

Product Gene Name

anti-IGFBP5 antibody

Product Synonym Names

Insulin-like growth factor-binding protein 5; IBP 5; IBP-5; IBP5; IBP5_HUMAN; IGF binding protein 5; IGF BP5; IGF-binding protein 5; IGFBP 5; IGFBP-5; IGFBP5; Insulin like growth factor binding protein 5; Insulin-like growth factor-binding protein 5; insulin-like growth factor binding protein 5

Clonality

Polyclonal

Species Reactivity

Human

Form/Format

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen Affinity Purified

Preparation and Storage

At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

30,570 Da

OMIM

146734

3D Structure

ModBase 3D Structure for P24593

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human IGFBP5 (76-114aa QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIER), different from the related mouse and rat sequences by two amino acids.

Ig Type

Rabbit IgG

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-IGFBP5 antibody

Western Blot (WB), ELISA (EIA)

Application Notes for anti-IGFBP5 antibody

ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml

Product References and Citations for anti-IGFBP5 antibody

1. Allander SV, Larsson C, Ehrenborg E, Suwanichkul A, Weber G, Morris SL, Bajalica S, Kiefer MC, Luthman H, Powell DR (May 1994). "Characterization of the chromosomal gene and promoter for human insulin-like growth factor binding protein-5". J Biol Chem 269 (14): 10891-8. 2. Butt, A. J., Dickson, K. A., McDougall, F., Baxter, R. C. Insulin-like growth factor-binding protein-5 inhibits the growth of human breast cancer cells in vitro and in vivo. J. Biol. Chem. 278: 29676-29685, 2003.

Other Notes

Small volumes of anti-IGFBP5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for IGFBP5 purchase

MBS177651 is an antibody targeting IGFBP5. Reactive in Human.

Additional Details

NCBI/Uniprot data below describe general gene information for IGFBP5. It may not necessarily be applicable to this product.

NCBI GI #

10834982

NCBI GeneID

3488

NCBI Accession #

NP_000590.1

UniProt Primary Accession #

P24593

UniProt Secondary Accession #

Q5U0A3

UniProt Related Accession #

P24593

GenBank Nucleotide #

NM_000599.3

NCBI Official Full Name

insulin-like growth factor-binding protein 5

NCBI Official Synonym Full Names

insulin like growth factor binding protein 5

NCBI Official Symbol

IGFBP5

NCBI Official Synonym Symbols

IBP5

UniProt Protein Name

Insulin-like growth factor-binding protein 5

Protein Family

Insulin-like growth factor-binding protein

UniProt Gene Name

IGFBP5

UniProt Synonym Gene Names

IBP5; IBP-5; IGF-binding protein 5; IGFBP-5

UniProt Entry Name

IBP5_HUMAN

NCBI Protein Information

insulin-like growth factor-binding protein 5

UniProt Comments for IGFBP5

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

Research Articles on IGFBP5

1. data provide further insights into the role of cellular compartmentalization in IGFBP-5-induced fibrosis

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-IGFBP5 antibody

Reference Product	PubMed Publications
IGF1 antibody	>34 publications with IGFBP5 and IGF1
IGF2 antibody	>17 publications with IGFBP5 and IGF2
PAPPA2 antibody	>3 publications with IGFBP5 and PAPPA2
SERPINE1 antibody	>1 publications with IGFBP5 and SERPINE1
THBS1 antibody	>1 publications with IGFBP5 and THBS1
FHL2 antibody	>1 publications with IGFBP5 and FHL2

Pathways associated with anti-IGFBP5 antibody

Products by Pathway	Pathway Diagram
Metabolism Of Proteins Pathway antibodies	Metabolism Of Proteins Pathway Diagram
Myometrial Relaxation And Contraction Pathways antibodies	Myometrial Relaxation And Contraction Pathways Diagram
Regulation Of Insulin-like Growth Factor (IGF) Transport And Uptake By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway antibodies	Regulation Of Insulin-like Growth Factor (IGF) Transport And Uptake By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway Diagram
Senescence And Autophagy Pathway antibodies	Senescence And Autophagy Pathway Diagram

Diseases associated with anti-IGFBP5 antibody

Disease Name	Pubmed Publications
Breast Neoplasms Antibodies	>53 publications with IGFBP5 and Breast Neoplasms
Nervous System Diseases Antibodies	>40 publications with IGFBP5 and Nervous System Diseases
Inflammation Antibodies	>26 publications with IGFBP5 and Inflammation
Necrosis Antibodies	>24 publications with IGFBP5 and Necrosis
Brain Diseases Antibodies	>23 publications with IGFBP5 and Brain Diseases
Cardiovascular Diseases Antibodies	>23 publications with IGFBP5 and Cardiovascular Diseases
Hypertrophy Antibodies	>22 publications with IGFBP5 and Hypertrophy
Fibrosis Antibodies	>20 publications with IGFBP5 and Fibrosis
Neoplasms, Experimental Antibodies	>18 publications with IGFBP5 and Neoplasms, Experimental
Kidney Diseases Antibodies	>17 publications with IGFBP5 and Kidney Diseases

Organs/Tissues associated with anti-IGFBP5 antibody

Organ/Tissue Name	Pubmed Publications
Muscle Antibodies	>155 publications with IGFBP5 and Muscle
Bone Antibodies	>133 publications with IGFBP5 and Bone
Ovary Antibodies	>70 publications with IGFBP5 and Ovary
Liver Antibodies	>56 publications with IGFBP5 and Liver
Vascular Antibodies	>56 publications with IGFBP5 and Vascular
Connective Tissue Antibodies	>55 publications with IGFBP5 and Connective Tissue
Brain Antibodies	>55 publications with IGFBP5 and Brain
Mammary Gland Antibodies	>48 publications with IGFBP5 and Mammary Gland
Kidney Antibodies	>43 publications with IGFBP5 and Kidney
Prostate Antibodies	>41 publications with IGFBP5 and Prostate