• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ARC Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177684

Description: Rabbit IgG polyclonal antibody for Activity-regulated cytoskeleton-associated protein(ARC) detection. Tested with WB in Human;Mouse;Rat.Background: ARC, officially called activity-regulated cytoskeleton-associated protein, is a plasticity protein… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Arc, Polyclonal Antibody
Full Product Name
Anti-Arc Antibody
Product Gene Name
anti-ARC antibody
Product Synonym Names
Activity-regulated cytoskeleton-associated protein; activity regulated cytoskeleton associated protein; activity regulated gene 3.1 protein homolog; Activity-regulated cytoskeleton-associated protein; Activity-regulated gene 3.1 protein homolog; Arc; ARC/ARG3.1; ARC_HUMAN; Arg3.1; activity-regulated cytoskeleton-associated protein
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
45,316 Da
OMIM
612461
3D Structure
ModBase 3D Structure for Q7LC44
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Arc (332-366aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-ARC antibody
Western Blot (WB)
Application Notes for anti-ARC antibody
Western Blot Concentration: 0.1-0.5ug/ml

Western Blot (WB) of anti-ARC antibody

Anti- Arc Picoband antibody, MBS177684, Western blotting
All lanes: Anti Arc (MBS177684) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Testis Tissue Lysate at 50ug
Lane 3: Mouse Brain Tissue Lysate at 50ug
Lane 4: PANC Whole Cell Lysate at 40ug
Lane 5: HELA Whole Cell Lysate at 40ug
Lane 6: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 45KD
Observed bind size: 45KD
Anti-ARC Polyclonal Antibody – Cat# MBS177684

Product References and Citations for anti-ARC antibody

1. Guzowski JF, McNaughton BL, Barnes CA, Worley PF (1999). "Environment-specific expression of the immediate-early gene Arc in hippocampal neuronal ensembles." Nature Neuroscience. 2:1120-1124. 2. Lyford GL, Yamagata K, Kaufmann WE, Barnes CA, Sanders LK, Copeland NG, Worley PF (1995). "Arc, a growth factor and activity-regulated gene, encodes a novel cytoskeletal-associated protein that is enriched in neuronal dendrites." Neuron. 14:433-445. 3. Link W, Konietzko U, Kauselmann G, Krug M, Schwanke B, Frey U, Kuhl D (1995). "Somatodendritic expression of an immediate early gene is regulated by synaptic activity." Proc Nat Acad Sci. 6;92(12):57 34-38. 4. Vazdarjanova A, McNaughton BL, Barnes CA, Worley PF, Guzowski JF (2002). "Experience-dependent coincident expression of the effector immediate-early genes Arc and Homer 1a in hippocampal and neocortical neuronal networks." J Neurosci. 1:10067-10071.

Other Notes

Small volumes of anti-ARC antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ARC purchase

MBS177684 is an antibody targeting ARC. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for ARC. It may not necessarily be applicable to this product.

NCBI GI #
8567330
NCBI GeneID
23237
NCBI Accession #
NP_056008.1
UniProt Primary Accession #
Q7LC44
UniProt Secondary Accession #
Q9UJW6; Q9Y469
UniProt Related Accession #
Q7LC44
GenBank Nucleotide #
NM_015193.4
NCBI Official Full Name
activity-regulated cytoskeleton-associated protein
NCBI Official Synonym Full Names
activity-regulated cytoskeleton-associated protein
NCBI Official Symbol
ARC
NCBI Official Synonym Symbols
Arg3.1
UniProt Protein Name
Activity-regulated cytoskeleton-associated protein
UniProt Synonym Protein Names
ARC/ARG3.1; Activity-regulated gene 3.1 protein homolog; Arg3.1
Protein Family
AAA ATPase forming ring-shaped complexes
UniProt Gene Name
ARC
UniProt Synonym Gene Names
Arg3.1
UniProt Entry Name
ARC_HUMAN
NCBI Protein Information
activity-regulated cytoskeleton-associated protein

UniProt Comments for ARC

ARG3.1: Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. Belongs to the ARC/ARG3.1 family.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: acrosome; actin cytoskeleton; cell junction; cytoplasm; dendritic spine; endosome; plasma membrane; postsynaptic density; postsynaptic membrane

Biological Process: anterior/posterior pattern formation; cell migration; cytoskeleton organization and biogenesis; endocytosis; endoderm development; learning; regulation of cell morphogenesis; regulation of neuronal synaptic plasticity
Show more

Research Articles on ARC

1. we propose that the peculiar characteristics of Arc protein, such as its optimal expression after ongoing experience or familiar behavior could explain how familiarization and recognition memories are stored and preserved in the mammalian brain--{REVIEW}

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ARC antibody

 Reference Product  PubMed Publications
 BDNF antibody  >188 publications with ARC and BDNF
 NOL3 antibody  >84 publications with ARC and NOL3
 UBE3A antibody  >16 publications with ARC and UBE3A
 UBC antibody  >8 publications with ARC and UBC
 DLG4 antibody  >4 publications with ARC and DLG4

Pathways associated with anti-ARC antibody

 Products by Pathway  Pathway Diagram
 Amphetamine Addiction Pathway antibodies  Amphetamine Addiction Pathway Diagram
 Amphetamine Addiction Pathway antibodies  Amphetamine Addiction Pathway Diagram

Diseases associated with anti-ARC antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >1970 publications with ARC and Nervous System Diseases
 Cardiovascular Diseases Antibodies  >990 publications with ARC and Cardiovascular Diseases
 Pain Antibodies  >871 publications with ARC and Pain
 Brain Diseases Antibodies  >805 publications with ARC and Brain Diseases
 Cognition Disorders Antibodies  >459 publications with ARC and Cognition Disorders
 Disease Models, Animal Antibodies  >333 publications with ARC and Disease Models, Animal
 Necrosis Antibodies  >309 publications with ARC and Necrosis
 Inflammation Antibodies  >266 publications with ARC and Inflammation
 Neurobehavioral Manifestations Antibodies  >231 publications with ARC and Neurobehavioral Manifestations
 Hypertension Antibodies  >187 publications with ARC and Hypertension

Organs/Tissues associated with anti-ARC antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >3559 publications with ARC and Brain
 Bone Antibodies  >1810 publications with ARC and Bone
 Eye Antibodies  >1389 publications with ARC and Eye
 Lung Antibodies  >755 publications with ARC and Lung
 Liver Antibodies  >355 publications with ARC and Liver
 Adrenal Gland Antibodies  >44 publications with ARC and Adrenal Gland
 Uncharacterized Tissue Antibodies  >5 publications with ARC and Uncharacterized Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000