• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SFTPA1/2 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177722

Description: Rabbit IgG polyclonal antibody for Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2(SFTPA1/2) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.Background: SFTPA1/2 is also known as SP-A. SFTPA1… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SFTPA1/2, Polyclonal Antibody
Full Product Name
Anti-SFTPA1/2 Antibody
Product Gene Name
anti-SFTPA1/2 antibody
Product Synonym Names
Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2; 35 kDa pulmonary surfactant associated protein; 35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; COLEC4; Collectin 4; Collectin-4; FLJ50593; FLJ51913; FLJ61144; FLJ77898,; FLJ79095; FLJ99559; MGC133365; MGC198590; OTTHUMP00000019928; OTTHUMP00000019929; OTTHUMP00000019930; OTTHUMP00000019931; PSAP; PSP A; PSP-A; PSPA; pulmonary surfactant -associated protein, 35-KD; pulmonary surfactant apoprotein PSP-A; pulmonary surfactant associated protein A1; Pulmonary surfactant-associated protein A1; SFTA1_HUMAN; SFTP1; SFTPA1; SFTPA1B; SP A; SP A1; SP-A; SP-A1; SPA; SPA1; surfactant protein A1; surfactant protein A1 variant AB'D' 6A2; surfactant protein A1 variant AB'D' 6A3; surfactant protein A1 variant AB'D' 6A4; surfactant protein A1 variant ACD' 6A2; surfactant protein A1 variant ACD' 6A3; surfactant protein A1 variant ACD' 6A4; surfactant protein A1 variant AD' 6A; surfactant protein A1 variant AD' 6A2; surfactant protein A1 variant AD' 6A3; surfactant protein A1 variant AD' 6A4; surfactant protein A1B; surfactant, pulmonary associated protein A1A; surfactant, pulmonary associated protein A1B; surfactant-associated protein, pulmonary 1; surfactant protein A1/surfactant protein A2
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
26,182 Da
OMIM
178500
3D Structure
ModBase 3D Structure for Q8IWL1
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2(206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-SFTPA1/2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Formalin/Paraffin
Application Notes for anti-SFTPA1/2 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunohistochemistry (IHC) Formalin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-SFTPA1/2 antibody

Anti- SFTP A1/2 Picoband antibody, MBS177722, Western blotting
All lanes: Anti SFTP (MBS177722) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Mouse Lung Tissue Lysate at 50ug
Lane 3: A549 Whole Cell Lysate at 40ug
Predicted bind size: 26KD
Observed bind size: 26KD
Anti-SFTPA1/2 Polyclonal Antibody – Cat# MBS177722

Immunohistochemistry (IHC) of anti-SFTPA1/2 antibody

Anti- SFTP A1/2 Picoband antibody, MBS177722, IHC(P)
IHC(P): Mouse Lung Tissue
Anti-SFTPA1/2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177722

Immunohistochemistry (IHC) of anti-SFTPA1/2 antibody

Anti- SFTP A1/2 Picoband antibody, MBS177722, IHC(P)
IHC(P): Rat Lung Tissue
Anti-SFTPA1/2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177722

Immunohistochemistry (IHC) of anti-SFTPA1/2 antibody

Anti- SFTP A1/2 Picoband antibody, MBS177722, IHC(P)
IHC(P): Human Lung Cancer Tissue
Anti-SFTPA1/2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177722

Immunohistochemistry (IHC) of anti-SFTPA1/2 antibody

Anti- SFTP A1/2 Picoband antibody, MBS177722, IHC(F)
IHC(F): Rat Lung Tissue
Anti-SFTPA1/2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177722

Immunohistochemistry (IHC) of anti-SFTPA1/2 antibody

Anti- SFTP A1/2 Picoband antibody, MBS177722, IHC(F)
IHC(F): Mouse Lung Tissue
Anti-SFTPA1/2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177722

Product References and Citations for anti-SFTPA1/2 antibody

1. Perez-Gil J, Weaver TE (June 2010). "Pulmonary surfactant pathophysiology: current models and open questions".Physiology (Bethesda) 25 (3): 132-41. 2. Phelps DS (2001). "Surfactant regulation of host defense function in the lung: a question of balance". Pediatr Pathol Mol Med 20 (4): 269-92.

Other Notes

Small volumes of anti-SFTPA1/2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SFTPA1/2 purchase

MBS177722 is an antibody targeting SFTPA1/2. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for SFTPA1/2. It may not necessarily be applicable to this product.

NCBI GI #
148886696
NCBI GeneID
729238
NCBI Accession #
NP_001092138.1
UniProt Primary Accession #
Q8IWL1
UniProt Secondary Accession #
P07714; Q14DV3; Q5RIR8; A4QPA7; B2RXI6; B2RXK9; C9J9I7; E3VLC6; E3VLC7; E3VLC8; E3VLC9
UniProt Related Accession #
Q8IWL1
GenBank Nucleotide #
NM_001098668.3
NCBI Official Full Name
pulmonary surfactant-associated protein A2 isoform 1
NCBI Official Synonym Full Names
surfactant protein A2
NCBI Official Symbol
SFTPA2
NCBI Official Synonym Symbols
PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SPAII; COLEC5; SFTPA2B
UniProt Protein Name
Pulmonary surfactant-associated protein A2
UniProt Synonym Protein Names
35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; Collectin-5
UniProt Gene Name
SFTPA2
UniProt Synonym Gene Names
COLEC5; PSAP; SFTP1; SFTPA; SFTPA2B; PSP-A; PSPA; SP-A; SP-A2
UniProt Entry Name
SFPA2_HUMAN
NCBI Protein Information
pulmonary surfactant-associated protein A2

NCBI Summary for SFTPA1/2

This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication. [provided by RefSeq, Sep 2009]
Show more

UniProt Comments for SFTPA1/2

SFTPA2: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Defects in SFTPA2 are a cause of pulmonary fibrosis idiopathic (IPF). Pulmonary fibrosis is a lung disease characterized by shortness of breath, radiographically evident diffuse pulmonary infiltrates, and varying degrees of inflammation and fibrosis on biopsy. It results in acute lung injury with subsequent scarring and endstage lung disease. Belongs to the SFTPA family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 10q22.3

Cellular Component: clathrin-coated endocytic vesicle; collagen; endoplasmic reticulum membrane; extracellular region; extracellular space; lamellar body; proteinaceous extracellular matrix

Molecular Function: carbohydrate binding

Biological Process: cellular protein metabolic process; respiratory gaseous exchange

Disease: Pulmonary Fibrosis, Idiopathic
Show more

Research Articles on SFTPA1/2

1. Significant differences in frequency of occurrence of unfavorable genotypes CC rs1965708, AA rs1059046 of SFTPA2 gene and CC rs1130866 of SFTPB gene in influenza patients in comparison with individuals of the control group were not detected.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SFTPA1/2 antibody

 Reference Product  PubMed Publications
 SFTPA1 antibody  >79 publications with SFTPA1/2 and SFTPA1
 SFTPC antibody  >14 publications with SFTPA1/2 and SFTPC
 SFTPB antibody  >4 publications with SFTPA1/2 and SFTPB
 ABCA3 antibody  >2 publications with SFTPA1/2 and ABCA3
 ELMOD2 antibody  >1 publications with SFTPA1/2 and ELMOD2
 EGFR antibody  >1 publications with SFTPA1/2 and EGFR

Pathways associated with anti-SFTPA1/2 antibody

 Products by Pathway  Pathway Diagram
 ABC Transporter Disorders Pathway antibodies  ABC Transporter Disorders Pathway Diagram
 Defective ABCA3 Causes Pulmonary Surfactant Metabolism Dysfunction Type 3 (SMDP3) Pathway antibodies  Defective ABCA3 Causes Pulmonary Surfactant Metabolism Dysfunction Type 3 (SMDP3) Pathway Diagram
 Defective CSF2RA Causes Pulmonary Surfactant Metabolism Dysfunction 4 (SMDP4) Pathway antibodies  Defective CSF2RA Causes Pulmonary Surfactant Metabolism Dysfunction 4 (SMDP4) Pathway Diagram
 Defective CSF2RB Causes Pulmonary Surfactant Metabolism Dysfunction 5 (SMDP5) Pathway antibodies  Defective CSF2RB Causes Pulmonary Surfactant Metabolism Dysfunction 5 (SMDP5) Pathway Diagram
 Defective SFTPA2 Causes Idiopathic Pulmonary Fibrosis (IPF) Pathway antibodies  Defective SFTPA2 Causes Idiopathic Pulmonary Fibrosis (IPF) Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Diseases Associated With Surfactant Metabolism Pathway antibodies  Diseases Associated With Surfactant Metabolism Pathway Diagram
 Diseases Of Metabolism Pathway antibodies  Diseases Of Metabolism Pathway Diagram
 Disorders Of Transmembrane Transporters Pathway antibodies  Disorders Of Transmembrane Transporters Pathway Diagram
 FOXA1 Transcription Factor Network Pathway antibodies  FOXA1 Transcription Factor Network Pathway Diagram

Diseases associated with anti-SFTPA1/2 antibody

 Disease Name  Pubmed Publications
 Respiratory Tract Diseases Antibodies  >44 publications with SFTPA1/2 and Respiratory Tract Diseases
 Lung Diseases Antibodies  >44 publications with SFTPA1/2 and Lung Diseases
 Fibrosis Antibodies  >17 publications with SFTPA1/2 and Fibrosis
 Inflammation Antibodies  >16 publications with SFTPA1/2 and Inflammation
 Lung Neoplasms Antibodies  >12 publications with SFTPA1/2 and Lung Neoplasms
 Idiopathic Pulmonary Fibrosis Antibodies  >12 publications with SFTPA1/2 and Idiopathic Pulmonary Fibrosis
 Pneumonia Antibodies  >11 publications with SFTPA1/2 and Pneumonia
 Carcinoma Antibodies  >9 publications with SFTPA1/2 and Carcinoma
 Respiration Disorders Antibodies  >6 publications with SFTPA1/2 and Respiration Disorders
 Lung Injury Antibodies  >4 publications with SFTPA1/2 and Lung Injury

Organs/Tissues associated with anti-SFTPA1/2 antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >75 publications with SFTPA1/2 and Lung
 Blood Antibodies  >8 publications with SFTPA1/2 and Blood
 Prostate Antibodies  >1 publications with SFTPA1/2 and Prostate
 Uncharacterized Tissue Antibodies  >1 publications with SFTPA1/2 and Uncharacterized Tissue
 Intestine Antibodies  >1 publications with SFTPA1/2 and Intestine
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000