• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Keratocan (KERA) Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177729

Description: Rabbit IgG polyclonal antibody for Keratocan(KERA) detection. Tested with WB in Human;Mouse.Background: Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Keratocan, Polyclonal Antibody
Full Product Name
Anti-Keratocan Antibody
Product Gene Name
anti-KERA antibody
Product Synonym Names
Keratocan; CNA2; KERA; KERA_HUMAN; Keratan sulfate proteoglycan keratocan; Keratocan; KTN; SLRR2B; keratocan
Clonality
Polyclonal
Species Reactivity
Human, Mouse
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
40,509 Da
OMIM
217300
3D Structure
ModBase 3D Structure for O60938
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Keratocan (77-109aa YLQNNLIETIPEKPFENATQLRWINLNKNKITN), different from the related mouse sequence by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-KERA antibody
Western Blot (WB)
Application Notes for anti-KERA antibody
Western Blot Concentration: 0.1-0.5ug/ml

Western Blot (WB) of anti-KERA antibody

Anti- Keratocan Picoband antibody, MBS177729, Western blotting
All lanes: Anti Keratocan (MBS177729) at 0.5ug/ml
Lane 1: Mouse Testis Whole Cell Lysate at 40ug
Lane 2: Mouse Skeletal Muscle Whole Cell Lysate at 40ug
Lane 3: MCF-7 Whole Cell Lysate at 40ug
Lane 4: A549 Whole Cell Lysate at 40ug
Predicted bind size: 40KD
Observed bind size: 50KD
Anti-KERA Polyclonal Antibody – Cat# MBS177729

Product References and Citations for anti-KERA antibody

1. "Entrez Gene: KERA keratocan". 2. Pellegata NS, Dieguez-Lucena JL, Joensuu T, Lau S, Montgomery KT, Krahe R, Kivela T, Kucherlapati R, Forsius H, de la Chapelle A (Jun 2000). "Mutations in KERA, encoding keratocan, cause cornea plana". Nat Genet 25(1): 91-5. 3. Tasheva ES, Funderburgh JL, Funderburgh ML, Corpuz LM, Conrad GW (Jan 2000). "Structure and sequence of the gene encoding human keratocan". DNA Seq 10 (1): 67-74.

Other Notes

Small volumes of anti-KERA antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for KERA purchase

MBS177729 is an antibody targeting KERA. Also known as Anti-Keratocan Antibody. Reactive in Human, Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for KERA. It may not necessarily be applicable to this product.

NCBI GI #
5901992
NCBI GeneID
11081
NCBI Accession #
NP_008966.1
UniProt Primary Accession #
O60938
UniProt Related Accession #
O60938
GenBank Nucleotide #
NM_007035.3
NCBI Official Full Name
keratocan
NCBI Official Synonym Full Names
keratocan
NCBI Official Symbol
KERA
NCBI Official Synonym Symbols
KTN; CNA2; SLRR2B
UniProt Protein Name
Keratocan
UniProt Synonym Protein Names
Keratan sulfate proteoglycan keratocan
Protein Family
Keratocan
UniProt Gene Name
KERA
UniProt Synonym Gene Names
SLRR2B; KTN
UniProt Entry Name
KERA_HUMAN
NCBI Protein Information
keratocan

NCBI Summary for KERA

The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2).[provided by RefSeq, May 2010]

UniProt Comments for KERA

KERA: May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix. Defects in KERA are the cause of the autosomal recessive cornea plana 2 (CNA2). In CNA2, the forward convex curvature is flattened, leading to a decrease in refraction, reduced visual activity, extreme hyperopia (usually plus 10 d or more), hazy corneal limbus, opacities in the corneal parenchyma, and marked arcus senilis (often detected at an early age). CNA2 is a rare disorder with a worldwide distribution, but a high prevalence in the Finnish population. Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 12q22

Cellular Component: extracellular region; extracellular space; Golgi lumen; lysosomal lumen; proteinaceous extracellular matrix

Biological Process: axonogenesis; keratan sulfate biosynthetic process; keratan sulfate catabolic process; response to stimulus; visual perception

Disease: Cornea Plana 2
Show more

Research Articles on KERA

1. a novel KERA variant, p.(Ile225Thr), was detected that segregates with Cornea plana in the homozygous form.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-KERA antibody

 Reference Product  PubMed Publications
 LUM antibody  >30 publications with KERA and LUM
 FMOD antibody  >4 publications with KERA and FMOD
 OGN antibody  >4 publications with KERA and OGN
 B3GNT7 antibody  >4 publications with KERA and B3GNT7
 CHST6 antibody  >3 publications with KERA and CHST6
 PRELP antibody  >1 publications with KERA and PRELP
 ACAN antibody  >1 publications with KERA and ACAN

Pathways associated with anti-KERA antibody

 Products by Pathway  Pathway Diagram
 Defective B4GALT1 Causes B4GALT1-CDG (CDG-2d) Pathway antibodies  Defective B4GALT1 Causes B4GALT1-CDG (CDG-2d) Pathway Diagram
 Defective CHST6 Causes MCDC1 Pathway antibodies  Defective CHST6 Causes MCDC1 Pathway Diagram
 Defective ST3GAL3 Causes MCT12 And EIEE15 Pathway antibodies  Defective ST3GAL3 Causes MCT12 And EIEE15 Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Diseases Associated With Glycosaminoglycan Metabolism Pathway antibodies  Diseases Associated With Glycosaminoglycan Metabolism Pathway Diagram
 Diseases Of Glycosylation Pathway antibodies  Diseases Of Glycosylation Pathway Diagram
 Glycosaminoglycan Metabolism Pathway antibodies  Glycosaminoglycan Metabolism Pathway Diagram
 Keratan Sulfate Biosynthesis Pathway antibodies  Keratan Sulfate Biosynthesis Pathway Diagram
 Keratan Sulfate Degradation Pathway antibodies  Keratan Sulfate Degradation Pathway Diagram
 Keratan Sulfate/keratin Metabolism Pathway antibodies  Keratan Sulfate/keratin Metabolism Pathway Diagram

Diseases associated with anti-KERA antibody

 Disease Name  Pubmed Publications
 Eye Abnormalities Antibodies  >11 publications with KERA and Eye Abnormalities
 Necrosis Antibodies  >7 publications with KERA and Necrosis
 Disease Models, Animal Antibodies  >6 publications with KERA and Disease Models, Animal
 Inflammation Antibodies  >5 publications with KERA and Inflammation
 Gonadal Disorders Antibodies  >3 publications with KERA and Gonadal Disorders
 Edema Antibodies  >3 publications with KERA and Edema
 Kidney Diseases Antibodies  >3 publications with KERA and Kidney Diseases
 Poisoning Antibodies  >2 publications with KERA and Poisoning
 Fatty Liver Antibodies  >2 publications with KERA and Fatty Liver
 Uterine Cervical Neoplasms Antibodies  >2 publications with KERA and Uterine Cervical Neoplasms

Organs/Tissues associated with anti-KERA antibody

 Organ/Tissue Name  Pubmed Publications
 Eye Antibodies  >94 publications with KERA and Eye
 Embryonic Tissue Antibodies  >11 publications with KERA and Embryonic Tissue
 Intestine Antibodies  >1 publications with KERA and Intestine
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000