• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MAOB Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177795

Description: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] B(MAOB) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Background: MAOB (MONOAMINE OXIDASE B), also called MAO, BRAIN, AMINE OXIDASE (FLAVIN-CONTAINING) B, is a protein… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MAOB, Polyclonal Antibody
Full Product Name
Anti-MAOB Antibody
Product Gene Name
anti-MAOB antibody
Product Synonym Names
Amine oxidase [flavin-containing] B; Adrenalin oxidase; Amine oxidase (flavin containing); Amine oxidase [flavin-containing] B; AOFB_HUMAN; HGNC:6834; MAO, brain; MAO, platelet; MAO-B; MAOB; MGC26382; Monoamine oxidase B; Monoamine oxidase type B; OTTHUMP00000023166; RP1 201D17__B.1; Tyramine oxidase antibody; monoamine oxidase B
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
46,539 Da
OMIM
309860
3D Structure
ModBase 3D Structure for P27338
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MAOB (448-484aa REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-MAOB antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-MAOB antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-MAOB antibody

Anti- MAOB Picoband antibody, MBS177795, Western blotting
All lanes: Anti MAOB (MBS177795) at 0.5ug/ml
Lane 1: Rat Cardiac MuscleTissue Lysate at 50ug
Lane 2: Rat Kidney Tissue Lysate at 50ug
Lane 3: Rat Intestine Tissue Lysate at 50ug
Lane 4: Mouse Kidney Tissue Lysate at 50ug
Lane 5: Mouse Intestine Tissue Lysate at 50ug
Lane 6: Mouse Cardiac Muscle Tissue Lysate at 50ug
Lane 7: HEPG2 Whole Cell Lysate at 40ug
Lane 8: HELA Whole Cell Lysate at 40ug
Lane 9: COLO320 Whole Cell Lysate at 40ug
Predicted bind size: 59KD
Observed bind size: 59KD
Anti-MAOB Polyclonal Antibody – Cat# MBS177795

Immunohistochemistry (IHC) of anti-MAOB antibody

Anti- MAOB Picoband antibody, MBS177795,IHC(P)
IHC(P): Mouse Intestine Tissue
Anti-MAOB Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177795

Immunohistochemistry (IHC) of anti-MAOB antibody

Anti- MAOB Picoband antibody, MBS177795,IHC(P)
IHC(P): Rat Intestine Tissue
Anti-MAOB Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177795

Immunohistochemistry (IHC) of anti-MAOB antibody

Anti- MAOB Picoband antibody, MBS177795,IHC(P)
IHC(P): Human Lung Cancer Tissue
Anti-MAOB Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177795

Western Blot (WB) of anti-MAOB antibody

Anti- MAOB Picoband antibody, MBS177795, Western blotting
All lanes: Anti MAOB (MBS177795) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Predicted bind size: 59KD
Observed bind size: 59KD
Anti-MAOB Polyclonal Antibody, Western Blot (WB) – Cat# MBS177795

Product References and Citations for anti-MAOB antibody

1. Bach, A. W., Lan, N. C., Johnson, D. L., Abell, C. W., Bembenek, M. E., Kwan, S.-W., Seeburg, P. H., Shih, J. C. cDNA cloning of human liver monoamine oxidase A and B: molecular basis of differences in enzymatic properties. Proc. Nat. Acad. Sci. 85: 4934-4938, 1988. 2. Binda, C., Newton-Vinson, P., Hubalek, F., Edmondson, D. E., Mattevi, A. Structure of human monoamine oxidase B, a drug target for the treatment of neurological disorders. Nature Struct. Biol. 9: 22-26, 2002. 3. Edmondson DE, Binda C, Mattevi A (2007). "STRUCTURAL INSIGHTS INTO THE MECHANISM OF AMINE OXIDATION BY MONOAMINE OXIDASES A AND B". Archives of Biochemistry and Biophysics 464 (2): 269-76.

Other Notes

Small volumes of anti-MAOB antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MAOB purchase

MBS177795 is an antibody targeting MAOB. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for MAOB. It may not necessarily be applicable to this product.

NCBI GI #
38202207
NCBI GeneID
4129
NCBI Accession #
NP_000889.3
UniProt Primary Accession #
P27338
UniProt Secondary Accession #
Q7Z6S2; B2R6R3; B7Z5H3; D3DWC3
UniProt Related Accession #
P27338
GenBank Nucleotide #
NM_000898.4
NCBI Official Full Name
amine oxidase
NCBI Official Synonym Full Names
monoamine oxidase B
NCBI Official Symbol
MAOB
UniProt Protein Name
Amine oxidase [flavin-containing] B
UniProt Synonym Protein Names
Monoamine oxidase type B; MAO-B
Protein Family
Amine oxidase
UniProt Gene Name
MAOB
UniProt Synonym Gene Names
MAO-B
UniProt Entry Name
AOFB_HUMAN
NCBI Protein Information
amine oxidase [flavin-containing] B

NCBI Summary for MAOB

The protein encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for MAOB

MAOB: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine. Belongs to the flavin monoamine oxidase family.

Protein type: Amino Acid Metabolism - histidine; Amino Acid Metabolism - arginine and proline; Amino Acid Metabolism - tryptophan; Oxidoreductase; Amino Acid Metabolism - tyrosine; EC 1.4.3.4; Membrane protein, integral; Amino Acid Metabolism - phenylalanine; Mitochondrial; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Amino Acid Metabolism - glycine, serine and threonine

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: integral to membrane; mitochondrial envelope; mitochondrial inner membrane; mitochondrial outer membrane; mitochondrion

Molecular Function: amine oxidase activity; electron carrier activity; FAD binding; protein homodimerization activity

Biological Process: dopamine catabolic process; hydrogen peroxide biosynthetic process; negative regulation of serotonin secretion; positive regulation of dopamine metabolic process; response to aluminum ion; response to corticosterone stimulus; response to drug; response to ethanol; response to lipopolysaccharide; response to selenium ion; response to toxin; substantia nigra development
Show more

Research Articles on MAOB

1. These findings demonstrate that regulation of monoamine levels by Mao activity in beta cells is pivotal for physiological insulin secretion and that loss of MaoB expression may contribute to the beta cell dysfunction in type 2 diabetes.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-MAOB antibody

 Products by Pathway  Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Alpha-synuclein Signaling Pathway antibodies  Alpha-synuclein Signaling Pathway Diagram
 Amine Oxidase Reactions Pathway antibodies  Amine Oxidase Reactions Pathway Diagram
 Amphetamine Addiction Pathway antibodies  Amphetamine Addiction Pathway Diagram
 Amphetamine Addiction Pathway antibodies  Amphetamine Addiction Pathway Diagram
 Arginine And Proline Metabolism Pathway antibodies  Arginine And Proline Metabolism Pathway Diagram
 Arginine And Proline Metabolism Pathway antibodies  Arginine And Proline Metabolism Pathway Diagram
 Biogenic Amines Are Oxidatively Deaminated To Aldehydes By MAOA And MAOB Pathway antibodies  Biogenic Amines Are Oxidatively Deaminated To Aldehydes By MAOA And MAOB Pathway Diagram
 Biological Oxidations Pathway antibodies  Biological Oxidations Pathway Diagram

Diseases associated with anti-MAOB antibody

 Disease Name  Pubmed Publications
 Mental Disorders Antibodies  >71 publications with MAOB and Mental Disorders
 Movement Disorders Antibodies  >50 publications with MAOB and Movement Disorders
 Parkinson Disease Antibodies  >44 publications with MAOB and Parkinson Disease
 Schizophrenia Antibodies  >17 publications with MAOB and Schizophrenia
 Neurobehavioral Manifestations Antibodies  >16 publications with MAOB and Neurobehavioral Manifestations
 Alzheimer Disease Antibodies  >6 publications with MAOB and Alzheimer Disease
 Autistic Disorder Antibodies  >6 publications with MAOB and Autistic Disorder
 Depressive Disorder Antibodies  >6 publications with MAOB and Depressive Disorder
 Anxiety Disorders Antibodies  >5 publications with MAOB and Anxiety Disorders
 Inflammation Antibodies  >4 publications with MAOB and Inflammation

Organs/Tissues associated with anti-MAOB antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >71 publications with MAOB and Brain
 Nerve Antibodies  >15 publications with MAOB and Nerve
 Liver Antibodies  >9 publications with MAOB and Liver
 Eye Antibodies  >7 publications with MAOB and Eye
 Muscle Antibodies  >6 publications with MAOB and Muscle
 Adrenal Gland Antibodies  >5 publications with MAOB and Adrenal Gland
 Kidney Antibodies  >5 publications with MAOB and Kidney
 Pituitary Gland Antibodies  >2 publications with MAOB and Pituitary Gland
 Thyroid Antibodies  >2 publications with MAOB and Thyroid
 Pancreas Antibodies  >2 publications with MAOB and Pancreas
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000