• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ZBTB7A Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177802

Description: Rabbit IgG polyclonal antibody for Zinc finger and BTB domain-containing protein 7A(ZBTB7A) detection. Tested with WB, IHC-P in Human.Background: Zinc finger and BTB domain-containing protein 7A is a protein that in humans is encoded by the… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ZBTB7A, Polyclonal Antibody
Full Product Name
Anti-ZBTB7A Antibody
Product Gene Name
anti-ZBTB7A antibody
Product Synonym Names
Zinc finger and BTB domain-containing protein 7A; DKFZp547O146; Factor binding IST protein 1; Factor that binds to inducer of short transcripts protein 1; FBI-1; FBI1; HIV-1 1st-binding protein 1; HIV-1 inducer of short transcripts binding protein; HIV-1 inducer of short transcripts-binding factor 1; Leukemia/lymphoma-related factor; LRF; lymphoma related factor; MGC99631; POK erythroid myeloid ontogenic factor; Pokemon; POZ and Krueppel erythroid myeloid ontogenic factor; TIP21; TTF-I-interacting peptide 21; ZBT7A_HUMAN; ZBTB7; ZBTB7A; Zinc finger and BTB domain containing 7A; zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein; Zinc finger and BTB domain-containing protein 7A; Zinc finger protein 857A; Zinc finger- and BTB domain-containing protein 7; ZNF857A; zinc finger and BTB domain containing 7A
Clonality
Polyclonal
Species Reactivity
Human
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
61,439 Da
OMIM
605878
3D Structure
ModBase 3D Structure for O95365
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125-163aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by ten amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-ZBTB7A antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-ZBTB7A antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-ZBTB7A antibody

Western blot analysis of ZBTB7A expression in HELA whole cell lysates (lane 1). ZBTB7A at 75KD was detected using rabbit anti- ZBTB7A Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
Anti-ZBTB7A Polyclonal Antibody – Cat# MBS177802

Immunohistochemistry (IHC) of anti-ZBTB7A antibody

ZBTB7A was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- ZBTB7A Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Anti-ZBTB7A Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177802

Product References and Citations for anti-ZBTB7A antibody

1. "Entrez Gene: ZBTB7A zinc finger and BTB domain containing 7A". 2. Wang, G., Lunardi, A., Zhang, J., Chen, Z., Ala, U., Webster, K. A., Tay, Y., Gonzalez-Billalabeitia, E., Egia, A., Shaffer, D. R., Carver, B., Liu, X.-S., Taulli, R., Kuo, W. P., Nardella, C., Signoretti, S., Cordon-Cardo, C., Gerald, W. L., Pandolfi, P. P. Zbtb7a suppresses prostate cancer through repression of a Sox9-dependent pathway for cellular senescence bypass and tumor invasion. Nature Genet. 45: 739-746, 2013.

Other Notes

Small volumes of anti-ZBTB7A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ZBTB7A purchase

MBS177802 is an antibody targeting ZBTB7A. Reactive in Human.

Additional Details

NCBI/Uniprot data below describe general gene information for ZBTB7A. It may not necessarily be applicable to this product.

NCBI GI #
966209768
NCBI GeneID
51341
NCBI Accession #
NP_001304919.1
UniProt Primary Accession #
O95365
UniProt Secondary Accession #
O00456; Q14D41; Q5XG86; D6W619
UniProt Related Accession #
O95365
GenBank Nucleotide #
NM_001317990.1
NCBI Official Full Name
zinc finger and BTB domain-containing protein 7A
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 7A
NCBI Official Symbol
ZBTB7A
NCBI Official Synonym Symbols
LRF; FBI1; FBI-1; TIP21; ZBTB7; ZNF857A; pokemon
UniProt Protein Name
Zinc finger and BTB domain-containing protein 7A
UniProt Synonym Protein Names
Factor binding IST protein 1; FBI-1; Factor that binds to inducer of short transcripts protein 1; HIV-1 1st-binding protein 1; Leukemia/lymphoma-related factor; POZ and Krueppel erythroid myeloid ontogenic factor; POK erythroid myeloid ontogenic factor; Pokemon; TTF-I-interacting peptide 21; TIP21; Zinc finger protein 857A
Protein Family
Zinc finger and BTB domain-containing protein
UniProt Gene Name
ZBTB7A
UniProt Synonym Gene Names
FBI1; LRF; ZBTB7; ZNF857A; FBI-1; POK erythroid myeloid ontogenic factor; Pokemon; TIP21
UniProt Entry Name
ZBT7A_HUMAN
NCBI Protein Information
zinc finger and BTB domain-containing protein 7A

UniProt Comments for ZBTB7A

FBI1: a widely expressed zinc finger protein. Apparently interacts with Bcl-6.

Protein type: C2H2-type zinc finger protein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleus

Molecular Function: DNA binding; histone acetyltransferase binding; metal ion binding; protein binding

Biological Process: cell differentiation; multicellular organismal development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; regulation of osteoclast differentiation; transcription, DNA-dependent
Show more

Research Articles on ZBTB7A

1. MEF2D was also found to increase the transcription of Pokemon by binding myocyte enhancer factor 2 (MEF2) sites within its promoter region, that can promote Hepatocellular carcinoma invasion

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ZBTB7A antibody

 Reference Product  PubMed Publications
 SP1 antibody  >13 publications with ZBTB7A and SP1
 CDKN1A antibody  >4 publications with ZBTB7A and CDKN1A
 TP53 antibody  >4 publications with ZBTB7A and TP53
 SREBF1 antibody  >1 publications with ZBTB7A and SREBF1
 BIRC5 antibody  >1 publications with ZBTB7A and BIRC5
 MBD3 antibody  >1 publications with ZBTB7A and MBD3
 NCOR2 antibody  >1 publications with ZBTB7A and NCOR2

Diseases associated with anti-ZBTB7A antibody

 Disease Name  Pubmed Publications
 Carcinoma, Hepatocellular Antibodies  >14 publications with ZBTB7A and Carcinoma, Hepatocellular
 Liver Neoplasms Antibodies  >13 publications with ZBTB7A and Liver Neoplasms
 Liver Diseases Antibodies  >13 publications with ZBTB7A and Liver Diseases
 Prostatic Neoplasms Antibodies  >8 publications with ZBTB7A and Prostatic Neoplasms
 Lung Diseases Antibodies  >6 publications with ZBTB7A and Lung Diseases
 Lung Neoplasms Antibodies  >6 publications with ZBTB7A and Lung Neoplasms
 Nervous System Diseases Antibodies  >3 publications with ZBTB7A and Nervous System Diseases
 Anemia Antibodies  >2 publications with ZBTB7A and Anemia
 Urinary Bladder Neoplasms Antibodies  >2 publications with ZBTB7A and Urinary Bladder Neoplasms
 Inflammation Antibodies  >2 publications with ZBTB7A and Inflammation

Organs/Tissues associated with anti-ZBTB7A antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >17 publications with ZBTB7A and Blood
 Bone Antibodies  >10 publications with ZBTB7A and Bone
 Lung Antibodies  >9 publications with ZBTB7A and Lung
 Prostate Antibodies  >8 publications with ZBTB7A and Prostate
 Brain Antibodies  >7 publications with ZBTB7A and Brain
 Thymus Antibodies  >6 publications with ZBTB7A and Thymus
 Lymph Node Antibodies  >5 publications with ZBTB7A and Lymph Node
 Connective Tissue Antibodies  >4 publications with ZBTB7A and Connective Tissue
 Bone Marrow Antibodies  >4 publications with ZBTB7A and Bone Marrow
 Embryonic Tissue Antibodies  >3 publications with ZBTB7A and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000