• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MAOA Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177836

Description: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] A(MAOA) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Background: MAOA(Monoamine oxidase A), also known as AMINE OXIDASE (FLAVIN-CONTAINING) A, is an enzyme that in humans… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MAOA, Polyclonal Antibody
Full Product Name
Anti-MAOA Antibody
Product Gene Name
anti-MAOA antibody
Product Synonym Names
Amine oxidase [flavin-containing] A; Amine oxidase [flavin containing] A; Amine oxidase [flavin-containing] A; AOFA; AOFA_HUMAN; EC 1.4.3.4; MAO A; MAO-A; Maoa; Monoamine oxidase A; Monoamine oxidase type A antibody; monoamine oxidase A
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
44,848 Da
OMIM
300615
3D Structure
ModBase 3D Structure for P21397
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MAOA (457-493aa REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-MAOA antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-MAOA antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-MAOA antibody

Anti- MAOA Picoband antibody, MBS177836, Western blotting
All lanes: Anti MAOA (MBS177836) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Lane 3: COLO320 Whole Cell Lysate at 40ug
Lane 4: HEPG2 Whole Cell Lysate at 40ug
Lane 5: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 60KD
Observed bind size: 60KD
Anti-MAOA Polyclonal Antibody – Cat# MBS177836

Immunohistochemistry (IHC) of anti-MAOA antibody

Anti- MAOA Picoband antibody, MBS177836,IHC(P)
IHC(P): Mouse Cardiac Muscle Tissue
Anti-MAOA Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177836

Immunohistochemistry (IHC) of anti-MAOA antibody

Anti- MAOA Picoband antibody, MBS177836,IHC(P)
IHC(P): Rat Cardiac Muscle Tissue
Anti-MAOA Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177836

Immunohistochemistry (IHC) of anti-MAOA antibody

Anti- MAOA Picoband antibody, MBS177836,IHC(P)
IHC(P): Human Intestinal Cancer Tissue
Anti-MAOA Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177836

Product References and Citations for anti-MAOA antibody

1. Breakefield, X. O., Ozelius, L., Hsu, Y. P., Powell, J., Utterback, M., Gusella, J. F., Bruns, G. A. Gene for A form of human monoamine oxidase (MAOA) maps to Xp21-Xp11. (Abstract) Am. J. Hum. Genet. 41: A209 only, 1987. 2. Brunner, H. G., Nelen, M., Breakefield, X. O., Ropers, H. H., van Oost, B. A. Abnormal behavior associated with a point mutation in the structural gene for monoamine oxidase A. Science 262: 578-580, 1993. 3. PDB 2BXS; De Colibus L, Li M, Binda C, Lustig A, Edmondson DE, Mattevi A (September 2005). "Three-dimensional structure of human monoamine oxidase A (MAO A): relation to the structures of rat MAO A and human MAO B".

Other Notes

Small volumes of anti-MAOA antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MAOA purchase

MBS177836 is an antibody targeting MAOA. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for MAOA. It may not necessarily be applicable to this product.

NCBI GI #
4557735
NCBI GeneID
4128
NCBI Accession #
NP_000231.1
UniProt Primary Accession #
P21397
UniProt Secondary Accession #
Q16426; B4DF46
UniProt Related Accession #
P21397
GenBank Nucleotide #
NM_000240.3
NCBI Official Full Name
amine oxidase
NCBI Official Synonym Full Names
monoamine oxidase A
NCBI Official Symbol
MAOA
NCBI Official Synonym Symbols
MAO-A
UniProt Protein Name
Amine oxidase [flavin-containing] A
UniProt Synonym Protein Names
Monoamine oxidase type A; MAO-A
Protein Family
Amine oxidase
UniProt Gene Name
MAOA
UniProt Synonym Gene Names
MAO-A
UniProt Entry Name
AOFA_HUMAN
NCBI Protein Information
amine oxidase [flavin-containing] A

NCBI Summary for MAOA

This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]
Show more

UniProt Comments for MAOA

MAOA: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. Defects in MAOA are the cause of Brunner syndrome (BRUNS). Brunner syndrome is a form of X-linked non- dysmorphic mild mental retardation. Male patients are affected by a syndrome of borderline mental retardation and exhibit abnormal behavior, including disturbed regulation of impulsive aggression. Obligate female carriers have normal intelligence and behavior. Belongs to the flavin monoamine oxidase family.

Protein type: Amino Acid Metabolism - glycine, serine and threonine; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Amino Acid Metabolism - tyrosine; Amino Acid Metabolism - histidine; EC 1.4.3.4; Oxidoreductase; Membrane protein, integral; Amino Acid Metabolism - phenylalanine; Amino Acid Metabolism - arginine and proline; Amino Acid Metabolism - tryptophan

Chromosomal Location of Human Ortholog: Xp11.3

Cellular Component: integral to membrane; mitochondrial outer membrane; mitochondrion

Molecular Function: amine oxidase activity; FAD binding; serotonin binding

Biological Process: biogenic amine metabolic process; dopamine catabolic process; neurotransmitter catabolic process; neurotransmitter metabolic process; phenylethylamine metabolic process; serotonin metabolic process

Disease: Brunner Syndrome
Show more

Research Articles on MAOA

1. The 3/3 genotype of the 30-bp VNTR polymorphism in the monoamine oxidase A promoter region does not contribute to the development of depressive symptoms in late-reproductive-age women.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MAOA antibody

 Reference Product  PubMed Publications
 COMT antibody  >113 publications with MAOA and COMT
 DBH antibody  >28 publications with MAOA and DBH
 DDC antibody  >11 publications with MAOA and DDC
 PNMT antibody  >4 publications with MAOA and PNMT
 ADH1B antibody  >2 publications with MAOA and ADH1B
 CYP2D6 antibody  >1 publications with MAOA and CYP2D6

Pathways associated with anti-MAOA antibody

 Products by Pathway  Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Amine Oxidase Reactions Pathway antibodies  Amine Oxidase Reactions Pathway Diagram
 Amphetamine Addiction Pathway antibodies  Amphetamine Addiction Pathway Diagram
 Amphetamine Addiction Pathway antibodies  Amphetamine Addiction Pathway Diagram
 Arginine And Proline Metabolism Pathway antibodies  Arginine And Proline Metabolism Pathway Diagram
 Arginine And Proline Metabolism Pathway antibodies  Arginine And Proline Metabolism Pathway Diagram
 Biogenic Amine Synthesis Pathway antibodies  Biogenic Amine Synthesis Pathway Diagram
 Biogenic Amines Are Oxidatively Deaminated To Aldehydes By MAOA And MAOB Pathway antibodies  Biogenic Amines Are Oxidatively Deaminated To Aldehydes By MAOA And MAOB Pathway Diagram
 Biological Oxidations Pathway antibodies  Biological Oxidations Pathway Diagram

Diseases associated with anti-MAOA antibody

 Disease Name  Pubmed Publications
 Mental Disorders Antibodies  >303 publications with MAOA and Mental Disorders
 Nervous System Diseases Antibodies  >95 publications with MAOA and Nervous System Diseases
 Antisocial Personality Disorder Antibodies  >58 publications with MAOA and Antisocial Personality Disorder
 Depressive Disorder Antibodies  >58 publications with MAOA and Depressive Disorder
 Brain Diseases Antibodies  >53 publications with MAOA and Brain Diseases
 Anxiety Disorders Antibodies  >39 publications with MAOA and Anxiety Disorders
 Autistic Disorder Antibodies  >12 publications with MAOA and Autistic Disorder
 Cardiovascular Diseases Antibodies  >12 publications with MAOA and Cardiovascular Diseases
 Parkinson Disease Antibodies  >11 publications with MAOA and Parkinson Disease
 Mental Retardation, X-Linked Antibodies  >11 publications with MAOA and Mental Retardation, X-Linked

Organs/Tissues associated with anti-MAOA antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >211 publications with MAOA and Brain
 Nerve Antibodies  >50 publications with MAOA and Nerve
 Eye Antibodies  >18 publications with MAOA and Eye
 Lung Antibodies  >14 publications with MAOA and Lung
 Liver Antibodies  >11 publications with MAOA and Liver
 Prostate Antibodies  >10 publications with MAOA and Prostate
 Skin Antibodies  >10 publications with MAOA and Skin
 Muscle Antibodies  >9 publications with MAOA and Muscle
 Heart Antibodies  >8 publications with MAOA and Heart
 Ganglia Antibodies  >7 publications with MAOA and Ganglia
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000