Anti-FSCN1 Polyclonal Antibody – Cat# MBS177840

Anti- Fascin Picoband antibody, MBS177840, Western blotting
All lanes: Anti Fascin (MBS177840) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: HELA Whole Cell Lysate at 40ug
Lane 4: SKOV Whole Cell Lysate at 40ug
Predicted bind size: 55KD
Observed bind size: 55KD

Fascin (FSCN1) Antibody – Polyclonal

Name: FSCN1 Antibody; Polyclonal; Human/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS177840
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177840

Description: Rabbit IgG polyclonal antibody for Fascin(FSCN1) detection. Tested with WB in Human;Rat.Background: Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Fascin (FSCN1), Polyclonal Antibody

Full Product Name

Anti-Fascin Antibody

Product Gene Name

anti-FSCN1 antibody

Product Synonym Names

Fascin; 55 kDa actin bundling protein; 55 kDa actin-bundling protein; Actin bundling protein; actin bundling protein, 55-KD; FAN 1; FAN1; Fascin 1; Fascin; Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus); Fascin homolog 1; Fascin, sea urchin, homolog of, 1; Fascin1; FLJ38511; FSCN 1; FSCN1; FSCN1_HUMAN; HSN; p55; Singed (Drosophila) like (sea urchin fascin homolog like); Singed drosophila homolog like; Singed like (fascin homolog sea urchin) (Drosophila); Singed like (fascin homolog sea urchin); Singed like protein; Singed, drosophila, homolog of; Singed-like protein; SNL; Strongylocentrotus purpuratus; fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)

Clonality

Polyclonal

Species Reactivity

Human, Rat

Form/Format

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen Affinity Purified

Preparation and Storage

At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

54,530 Da

OMIM

602689

3D Structure

ModBase 3D Structure for Q16658

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Ig Type

Rabbit IgG

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-FSCN1 antibody

Western Blot (WB)

Application Notes for anti-FSCN1 antibody

Western Blot Concentration: 0.1-0.5ug/ml

Product References and Citations for anti-FSCN1 antibody

1. Saishin, Y., Shimada, S., Morimura, H., Sato, K., Ishimoto, I., Tano, Y., Tohyama, M.Isolation of a cDNA encoding a photoreceptor cell-specific actin-bundling protein: retinal fascin.FEBS Lett. 414: 381-386, 1997. 2. Wada, Y., Abe, T., Takeshita, T., Sato, H., Yanashima, K., Tamai, M.Mutation of human retinal fascin gene (FSCN2) causes autosomal dominant retinitis pigmentosa.Invest. Ophthal. Vis. Sci. 42: 2395-2400, 2001.

Other Notes

Small volumes of anti-FSCN1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for FSCN1 purchase

MBS177840 is an antibody targeting FSCN1. Also known as Anti-Fascin Antibody. Reactive in Human, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for FSCN1. It may not necessarily be applicable to this product.

NCBI GI #

4507115

NCBI GeneID

6624

NCBI Accession #

NP_003079.1

UniProt Primary Accession #

Q16658

UniProt Secondary Accession #

Q96IC5; Q96IH1; Q9BRF1; A6NI89; B2RE97

UniProt Related Accession #

Q16658

GenBank Nucleotide #

NM_003088.3

NCBI Official Full Name

fascin

NCBI Official Synonym Full Names

fascin actin-bundling protein 1

NCBI Official Symbol

FSCN1

NCBI Official Synonym Symbols

HSN; SNL; p55; FAN1

UniProt Protein Name

Fascin

UniProt Synonym Protein Names

55 kDa actin-bundling protein; Singed-like protein; p55

Protein Family

Fascin

UniProt Gene Name

FSCN1

UniProt Synonym Gene Names

FAN1; HSN; SNL

UniProt Entry Name

FSCN1_HUMAN

NCBI Protein Information

fascin

NCBI Summary for FSCN1

This gene encodes a member of the fascin family of actin-binding proteins. Fascin proteins organize F-actin into parallel bundles, and are required for the formation of actin-based cellular protrusions. The encoded protein plays a critical role in cell migration, motility, adhesion and cellular interactions. Expression of this gene is known to be regulated by several microRNAs, and overexpression of this gene may play a role in the metastasis of multiple types of cancer by increasing cell motility. Expression of this gene is also a marker for Reed-Sternberg cells in Hodgkin's lymphoma. A pseudogene of this gene is located on the long arm of chromosome 15. [provided by RefSeq, Sep 2011]

UniProt Comments for FSCN1

Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration.

Research Articles on FSCN1

1. FSCN1 plays an important role in non-small cell lung cancer progression and prognosis.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-FSCN1 antibody

Products by Pathway	Pathway Diagram
MicroRNAs In Cancer Pathway antibodies	MicroRNAs In Cancer Pathway Diagram
MicroRNAs In Cancer Pathway antibodies	MicroRNAs In Cancer Pathway Diagram

Diseases associated with anti-FSCN1 antibody

Disease Name	Pubmed Publications
Neoplasm Metastasis Antibodies	>25 publications with FSCN1 and Neoplasm Metastasis
Breast Neoplasms Antibodies	>11 publications with FSCN1 and Breast Neoplasms
Lung Neoplasms Antibodies	>8 publications with FSCN1 and Lung Neoplasms
Urinary Bladder Neoplasms Antibodies	>7 publications with FSCN1 and Urinary Bladder Neoplasms
Ovarian Neoplasms Antibodies	>7 publications with FSCN1 and Ovarian Neoplasms
Lung Diseases Antibodies	>6 publications with FSCN1 and Lung Diseases
Liver Neoplasms Antibodies	>5 publications with FSCN1 and Liver Neoplasms
Carcinoma, Hepatocellular Antibodies	>5 publications with FSCN1 and Carcinoma, Hepatocellular
Pancreatic Neoplasms Antibodies	>4 publications with FSCN1 and Pancreatic Neoplasms
Liver Diseases Antibodies	>4 publications with FSCN1 and Liver Diseases

Organs/Tissues associated with anti-FSCN1 antibody

Organ/Tissue Name	Pubmed Publications
Lung Antibodies	>13 publications with FSCN1 and Lung
Lymph Node Antibodies	>13 publications with FSCN1 and Lymph Node
Blood Antibodies	>11 publications with FSCN1 and Blood
Stomach Antibodies	>9 publications with FSCN1 and Stomach
Bladder Antibodies	>9 publications with FSCN1 and Bladder
Brain Antibodies	>7 publications with FSCN1 and Brain
Liver Antibodies	>5 publications with FSCN1 and Liver
Bone Antibodies	>5 publications with FSCN1 and Bone
Vascular Antibodies	>4 publications with FSCN1 and Vascular
Muscle Antibodies	>4 publications with FSCN1 and Muscle