• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

DARPP32 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177854

Description: Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B(PPP1R1B) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Background: Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
DARPP32, Polyclonal Antibody
Full Product Name
Anti-DARPP32 Antibody
Product Gene Name
anti-DARPP32 antibody
Product Synonym Names
Protein phosphatase 1 regulatory subunit 1B; DARPP 32; DARPP-32; Dopamine and cAMP regulated neuronal phosphoprotein 32; Dopamine and cAMP regulated neuronal phosphoprotein; Dopamine and cAMP regulated phosphoprotein; Dopamine and cAMP regulated phosphoprotein DARPP 32; Dopamine and cAMP regulated phosphoprotein DARPP32; Dopamine- and cAMP-regulated neuronal phosphoprotein; FLJ20940; IPPD; Neuronal phosphoprotein DARPP 32; PPP1R1B; PPR1B_HUMAN; Protein phosphatase 1 regulatory (inhibitor) subunit 1B; Protein phosphatase 1 regulatory subunit 1B; protein phosphatase 1 regulatory inhibitor subunit 1B
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
18,738 Da
OMIM
604399
3D Structure
ModBase 3D Structure for Q9UD71
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-DARPP32 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-DARPP32 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-DARPP32 antibody

Western blot analysis of DARPP32 expression in rat brain extract (lane 1), SW620 whole cell lysates (lane 2), 22RV1 whole cell lysates (lane 3) and HELA whole cell lysates (lane 4). DARPP32 at 34KD, 39KD was detected using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.
Anti-DARPP32 Polyclonal Antibody – Cat# MBS177854

Immunohistochemistry (IHC) of anti-DARPP32 antibody

DARPP32 was detected in paraffin-embedded sections of mouse pancreas tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.
Anti-DARPP32 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177854

Immunohistochemistry (IHC) of anti-DARPP32 antibody

DARPP32 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Anti-DARPP32 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177854

Immunohistochemistry (IHC) of anti-DARPP32 antibody

DARPP32 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- DARPP32 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Anti-DARPP32 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177854

Product References and Citations for anti-DARPP32 antibody

1. "Entrez Gene: PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32)". 2. Brené S, Lindefors N, Ehrlich M, Taubes T, Horiuchi A, Kopp J, Hall H, Sedvall G, Greengard P, Persson H (March 1994). "Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue". J. Neurosci. 14 (3 Pt 1): 985-98. 3. Ouimet CC, Greengard P (February 1990). "Distribution of DARPP-32 in the basal ganglia: an electron microscopic study". J. Neurocytol. 19 (1): 39-52.

Other Notes

Small volumes of anti-DARPP32 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for DARPP32 purchase

MBS177854 is an antibody targeting DARPP32. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for DARPP32. It may not necessarily be applicable to this product.

NCBI GI #
335057524
NCBI GeneID
84152
NCBI Accession #
NP_001229393.1
UniProt Primary Accession #
Q9UD71
UniProt Secondary Accession #
Q547V9; Q547W0; Q9H7G1
UniProt Related Accession #
Q9UD71
GenBank Nucleotide #
NM_001242464.1
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 1B isoform 2
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory inhibitor subunit 1B
NCBI Official Symbol
PPP1R1B
NCBI Official Synonym Symbols
DARPP32; DARPP-32
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 1B
UniProt Synonym Protein Names
DARPP-32; Dopamine- and cAMP-regulated neuronal phosphoprotein
UniProt Gene Name
PPP1R1B
UniProt Synonym Gene Names
DARPP32
UniProt Entry Name
PPR1B_HUMAN
NCBI Protein Information
protein phosphatase 1 regulatory subunit 1B

NCBI Summary for DARPP32

This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Show more

UniProt Comments for DARPP32

DARPP-32: a member of the protein phosphatase inhibitor 1 family. A dopamine- and cyclic AMP-regulated neuronal phosphoprotein. Both dopaminergic and glutamatergic (NMDA) receptor stimulation regulate the extent of DARPP32 phosphorylation, but in opposite directions. Dopamine D1 receptor stimulation enhances cAMP formation, resulting in the phosphorylation of DARPP32; phosphorylated DARPP32 is a potent protein phosphatase-1 inhibitor. NMDA receptor stimulation elevates intracellular calcium, which leads to activation of calcineurin and dephosphorylation of phospho-DARPP32, thereby reducing the phosphatase-1 inhibitory activity of DARPP32. Two alternatively-spliced isoforms have been described.

Protein type: Protein phosphatase, regulatory subunit; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: cell soma; cytoplasm; cytosol; nucleus

Molecular Function: cAMP-dependent protein kinase inhibitor activity; D1 dopamine receptor binding; D2 dopamine receptor binding; D3 dopamine receptor binding; D4 dopamine receptor binding; D5 dopamine receptor binding; protein binding; protein kinase inhibitor activity; protein phosphatase inhibitor activity; protein phosphatase type 1 regulator activity; type 1 serine/threonine specific protein phosphatase inhibitor activity

Biological Process: negative regulation of catalytic activity; negative regulation of female receptivity; negative regulation of protein kinase activity; regulation of catalytic activity; response to amphetamine; signal transduction; transcription, DNA-dependent; visual learning
Show more

Research Articles on DARPP32

1. Findings show that PPP1R1B-STARD3 fusion transcript has a key role in subsets of gastric cancers through the activation of PI3K/AKT signaling.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-DARPP32 antibody

 Reference Product  PubMed Publications
 CDK5 antibody  >14 publications with DARPP32 and CDK5
 CDK5R1 antibody  >2 publications with DARPP32 and CDK5R1

Pathways associated with anti-DARPP32 antibody

 Products by Pathway  Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Amphetamine Addiction Pathway antibodies  Amphetamine Addiction Pathway Diagram
 Amphetamine Addiction Pathway antibodies  Amphetamine Addiction Pathway Diagram
 Cocaine Addiction Pathway antibodies  Cocaine Addiction Pathway Diagram
 Cocaine Addiction Pathway antibodies  Cocaine Addiction Pathway Diagram
 DARPP-32 Events Pathway antibodies  DARPP-32 Events Pathway Diagram
 Dopaminergic Synapse Pathway antibodies  Dopaminergic Synapse Pathway Diagram
 Dopaminergic Synapse Pathway antibodies  Dopaminergic Synapse Pathway Diagram
 Nicotine Activity On Dopaminergic Neurons Pathway antibodies  Nicotine Activity On Dopaminergic Neurons Pathway Diagram

Diseases associated with anti-DARPP32 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >72 publications with DARPP32 and Nervous System Diseases
 Brain Diseases Antibodies  >57 publications with DARPP32 and Brain Diseases
 Movement Disorders Antibodies  >52 publications with DARPP32 and Movement Disorders
 Disease Models, Animal Antibodies  >44 publications with DARPP32 and Disease Models, Animal
 Dyskinesias Antibodies  >38 publications with DARPP32 and Dyskinesias
 Cognition Disorders Antibodies  >29 publications with DARPP32 and Cognition Disorders
 Dyskinesia, Drug-Induced Antibodies  >12 publications with DARPP32 and Dyskinesia, Drug-Induced
 Neurotoxicity Syndromes Antibodies  >12 publications with DARPP32 and Neurotoxicity Syndromes
 Drug-Related Side Effects and Adverse Reactions Antibodies  >10 publications with DARPP32 and Drug-Related Side Effects and Adverse Reactions
 Learning Disorders Antibodies  >6 publications with DARPP32 and Learning Disorders

Organs/Tissues associated with anti-DARPP32 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >203 publications with DARPP32 and Brain
 Nerve Antibodies  >42 publications with DARPP32 and Nerve
 Stomach Antibodies  >13 publications with DARPP32 and Stomach
 Blood Antibodies  >8 publications with DARPP32 and Blood
 Eye Antibodies  >5 publications with DARPP32 and Eye
 Lung Antibodies  >4 publications with DARPP32 and Lung
 Heart Antibodies  >3 publications with DARPP32 and Heart
 Prostate Antibodies  >2 publications with DARPP32 and Prostate
 Muscle Antibodies  >1 publications with DARPP32 and Muscle
 Placenta Antibodies  >1 publications with DARPP32 and Placenta
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000