• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SOX5 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177856

Description: Rabbit IgG polyclonal antibody for Transcription factor SOX-5(SOX5) detection. Tested with WB in Human;Rat.Background: Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SOX5, Polyclonal Antibody
Full Product Name
Anti-SOX5 Antibody
Product Gene Name
anti-SOX5 antibody
Product Synonym Names
Transcription factor SOX-5; L SOX5; MGC35153; Sex determining region Y box 5; SOX 5; SOX 5 protein; Sox5; SOX5 protein; SOX5_HUMAN; SRY (sex determining region Y) box 5; SRY box 5; Transcription factor SOX 5; Transcription factor SOX-5; Transcription factor SOX5; SRY (sex determining region Y)-box 5
Clonality
Polyclonal
Species Reactivity
Human, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
82,770 Da
OMIM
604975
3D Structure
ModBase 3D Structure for P35711
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-SOX5 antibody
Western Blot (WB)
Application Notes for anti-SOX5 antibody
Western Blot Concentration: 0.1-0.5ug/ml

Western Blot (WB) of anti-SOX5 antibody

Anti- SOX5 Picoband antibody, MBS177856, Western blotting
All lanes: Anti SOX5 (MBS177856) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Testis Tissue Lysate at 50ug
Lane 3: Rat Brain Tissue Lysate at 50ug
Lane 4: HELA Whole Cell Lysate at 40ug
Lane 5: A549 Whole Cell Lysate at 40ug
Predicted bind size: 84KD
Observed bind size: 84KD
Anti-SOX5 Polyclonal Antibody – Cat# MBS177856

Western Blot (WB) of anti-SOX5 antibody

Figure 2. Western blot analysis of SOX5 using anti-SOX5 antibody (MBS177856).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 40ug of sample under reducing conditions.
All lanes: pig adipose cells
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SOX5 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for SOX5 at approximately 84KD. The expected band size for SOX5 is at 84KD.
Anti-SOX5 Polyclonal Antibody, Western Blot (WB) – Cat# MBS177856

Product References and Citations for anti-SOX5 antibody

1. "Entrez Gene: SOX5 SRY (sex determining region Y)-box 5". 2. Ikeda T; Zhang J; Chano T et al. (2003). "Identification and characterization of the human long form of Sox5 (L-SOX5) gene". Gene 298 (1): 59-68. 3. Wunderle VM, Critcher R, Ashworth A, Goodfellow PN (Jan 1997). "Cloning and characterization of SOX5, a new member of the human SOX gene family". Genomics 36 (2): 354-8.

Other Notes

Small volumes of anti-SOX5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SOX5 purchase

MBS177856 is an antibody targeting SOX5. Reactive in Human, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for SOX5. It may not necessarily be applicable to this product.

NCBI GI #
387157920
NCBI GeneID
6660
NCBI Accession #
NP_001248343.1
UniProt Primary Accession #
P35711
UniProt Secondary Accession #
Q86UK8; Q8J017; Q8J018; Q8J019; Q8J020; Q8N1D9; Q8N7E0; Q8TEA4; B7Z8V0; F5H5B0
UniProt Related Accession #
P35711
GenBank Nucleotide #
NM_001261414.1
NCBI Official Full Name
transcription factor SOX-5 isoform d
NCBI Official Synonym Full Names
SRY-box 5
NCBI Official Symbol
SOX5
NCBI Official Synonym Symbols
L-SOX5; LAMSHF; L-SOX5B; L-SOX5F
UniProt Protein Name
Transcription factor SOX-5
Protein Family
Transcription factor
UniProt Gene Name
SOX5
UniProt Entry Name
SOX5_HUMAN
NCBI Protein Information
transcription factor SOX-5

NCBI Summary for SOX5

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for SOX5

SOX5: Binds specifically to the DNA sequence 5'-AACAAT-3'. Activates transcription of COL2A1 and AGC1 in vitro. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12p12.1

Cellular Component: nucleus

Molecular Function: DNA binding; protein binding; transcription factor activity

Biological Process: asymmetric neuroblast division; positive regulation of chondrocyte differentiation; regulation of transcription, DNA-dependent; transcription from RNA polymerase II promoter
Show more

Research Articles on SOX5

1. Our results indicate for the first time that SOX5 is a novel regulator of epithelial-mesenchymal transition in hepatocellular carcinoma

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SOX5 antibody

 Reference Product  PubMed Publications
 COL2A1 antibody  >33 publications with SOX5 and COL2A1
 FEZF2 antibody  >10 publications with SOX5 and FEZF2
 ACAN antibody  >7 publications with SOX5 and ACAN
 MITF antibody  >3 publications with SOX5 and MITF
 RHOB antibody  >2 publications with SOX5 and RHOB
 SHOX2 antibody  >1 publications with SOX5 and SHOX2

Pathways associated with anti-SOX5 antibody

 Products by Pathway  Pathway Diagram
 Endochondral Ossification Pathway antibodies  Endochondral Ossification Pathway Diagram
 Neural Crest Differentiation Pathway antibodies  Neural Crest Differentiation Pathway Diagram

Diseases associated with anti-SOX5 antibody

 Disease Name  Pubmed Publications
 Hypertrophy Antibodies  >11 publications with SOX5 and Hypertrophy
 Immune System Diseases Antibodies  >9 publications with SOX5 and Immune System Diseases
 Cardiovascular Diseases Antibodies  >6 publications with SOX5 and Cardiovascular Diseases
 Breast Neoplasms Antibodies  >5 publications with SOX5 and Breast Neoplasms
 Neurobehavioral Manifestations Antibodies  >4 publications with SOX5 and Neurobehavioral Manifestations
 Cell Transformation, Neoplastic Antibodies  >4 publications with SOX5 and Cell Transformation, Neoplastic
 Neoplasms, Experimental Antibodies  >4 publications with SOX5 and Neoplasms, Experimental
 Atrial Fibrillation Antibodies  >4 publications with SOX5 and Atrial Fibrillation
 Liver Diseases Antibodies  >3 publications with SOX5 and Liver Diseases
 Disease Models, Animal Antibodies  >3 publications with SOX5 and Disease Models, Animal

Organs/Tissues associated with anti-SOX5 antibody

 Organ/Tissue Name  Pubmed Publications
 Connective Tissue Antibodies  >42 publications with SOX5 and Connective Tissue
 Brain Antibodies  >36 publications with SOX5 and Brain
 Embryonic Tissue Antibodies  >28 publications with SOX5 and Embryonic Tissue
 Blood Antibodies  >17 publications with SOX5 and Blood
 Testis Antibodies  >14 publications with SOX5 and Testis
 Skin Antibodies  >10 publications with SOX5 and Skin
 Lung Antibodies  >8 publications with SOX5 and Lung
 Eye Antibodies  >4 publications with SOX5 and Eye
 Kidney Antibodies  >2 publications with SOX5 and Kidney
 Mouth Antibodies  >1 publications with SOX5 and Mouth
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000