Anti-HKDC1 Polyclonal Antibody – Cat# MBS177860

Anti-HKDC1 Picoband antibody, MBS177860, Western blotting
All lanes: Anti HKDC1 (MBS177860) at 0.5ug/ml
Lane 1: 293T Whole Cell Lysate at 40ug
Lane 2: SW620 Whole Cell Lysate at 40ug
Lane 3: COLO320 Whole Cell Lysate at 40ug
Lane 4: HELA Whole Cell Lysate at 40ug
Predicted bind size: 103KD
Observed bind size: 170KD

HKDC1 Antibody – Polyclonal

Name: HKDC1 Antibody; Polyclonal; Human-Reactive; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS177860
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177860

Description: Rabbit IgG polyclonal antibody for Putative hexokinase HKDC1(HKDC1) detection. Tested with WB in Human.Background: The epidermal growth factor receptor (HKDC1; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

HKDC1, Polyclonal Antibody

Full Product Name

Anti-HKDC1 Antibody

Product Gene Name

anti-HKDC1 antibody

Product Synonym Names

Putative hexokinase HKDC1; BC016235; Hexokinase domain-containing protein 1; Hkdc1; HKDC1_HUMAN; Putative hexokinase HKDC1; hexokinase domain containing 1

Clonality

Polyclonal

Species Reactivity

Human

Form/Format

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen Affinity Purified

Preparation and Storage

At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

82,682 Da

3D Structure

ModBase 3D Structure for Q2TB90

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human HKDC1(102-136aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD), different from the related mouse sequence by four amino acids.

Ig Type

Rabbit IgG

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-HKDC1 antibody

Western Blot (WB)

Application Notes for anti-HKDC1 antibody

Western Blot Concentration: 0.1-0.5ug/ml

Product References and Citations for anti-HKDC1 antibody

1. Herbst RS (2004). "Review of epidermal growth factor receptor biology". Int. J. Radiat. Oncol. Biol. Phys. 59 (2 Suppl): 21-6. 2. Wang, K.; Yamamoto, H.; Chin, J. R.; Werb, Z.; Vu, T. H.: Epidermal growth factor receptor-deficient mice have delayed primary endochondral ossification because of defective osteoclast recruitment. J. Biol. Chem. 279: 53848-53856, 2004. 3. Kuan CT, Wikstrand CJ, Bigner DD (June 2001). "EGF mutant receptor vIII as a molecular target in cancer therapy". Endocr. Relat. Cancer 8 (2): 83-96.

Other Notes

Small volumes of anti-HKDC1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HKDC1 purchase

MBS177860 is an antibody targeting HKDC1. Reactive in Human.

Additional Details

NCBI/Uniprot data below describe general gene information for HKDC1. It may not necessarily be applicable to this product.

NCBI GI #

156151420

NCBI GeneID

80201

NCBI Accession #

NP_079406.3

UniProt Primary Accession #

Q2TB90

UniProt Secondary Accession #

Q2TB91; Q5VTC7; Q7Z373; Q8WU37; Q96EH2; Q9H5Y9; B5MDN9

UniProt Related Accession #

Q2TB90

GenBank Nucleotide #

NM_025130.3

NCBI Official Full Name

putative hexokinase HKDC1

NCBI Official Synonym Full Names

hexokinase domain containing 1

NCBI Official Symbol

HKDC1

UniProt Protein Name

Putative hexokinase HKDC1

UniProt Synonym Protein Names

Hexokinase domain-containing protein 1

Protein Family

Putative hexokinase

UniProt Gene Name

HKDC1

UniProt Entry Name

HKDC1_HUMAN

NCBI Protein Information

putative hexokinase HKDC1

UniProt Comments for HKDC1

HKDC1: Belongs to the hexokinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.1.1; Kinase, other

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: cytosol

Molecular Function: ATP binding; fructokinase activity; glucokinase activity; glucose binding; mannokinase activity

Biological Process: carbohydrate phosphorylation; cell glucose homeostasis; glucose 6-phosphate metabolic process; glycolysis; hexose metabolic process

Research Articles on HKDC1

1. Data identified two novel genome-wide significant associations: 2-h plasma glucose and HKDC1, and fasting C-peptide and BACE2.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-HKDC1 antibody

Products by Pathway	Pathway Diagram
Amino Sugar And Nucleotide Sugar Metabolism Pathway antibodies	Amino Sugar And Nucleotide Sugar Metabolism Pathway Diagram
Amino Sugar And Nucleotide Sugar Metabolism Pathway antibodies	Amino Sugar And Nucleotide Sugar Metabolism Pathway Diagram
Butirosin And Neomycin Biosynthesis Pathway antibodies	Butirosin And Neomycin Biosynthesis Pathway Diagram
Butirosin And Neomycin Biosynthesis Pathway antibodies	Butirosin And Neomycin Biosynthesis Pathway Diagram
Carbohydrate Digestion And Absorption Pathway antibodies	Carbohydrate Digestion And Absorption Pathway Diagram
Carbohydrate Digestion And Absorption Pathway antibodies	Carbohydrate Digestion And Absorption Pathway Diagram
Carbon Metabolism Pathway antibodies	Carbon Metabolism Pathway Diagram
Carbon Metabolism Pathway antibodies	Carbon Metabolism Pathway Diagram
Central Carbon Metabolism In Cancer Pathway antibodies	Central Carbon Metabolism In Cancer Pathway Diagram
Central Carbon Metabolism In Cancer Pathway antibodies	Central Carbon Metabolism In Cancer Pathway Diagram

Organs/Tissues associated with anti-HKDC1 antibody

Organ/Tissue Name	Pubmed Publications
Muscle Antibodies	>1 publications with HKDC1 and Muscle
Liver Antibodies	>1 publications with HKDC1 and Liver
Lung Antibodies	>1 publications with HKDC1 and Lung
Thyroid Antibodies	>1 publications with HKDC1 and Thyroid