• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

HSPA2 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177867

Description: Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2(HSPA2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Background: HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
HSPA2, Polyclonal Antibody
Full Product Name
Anti-HSPA2 Antibody
Product Gene Name
anti-HSPA2 antibody
Product Synonym Names
Heat shock-related 70 kDa protein 2; 70kDa; DAQB 147D11.1 001; Hcp70.2; Heat shock 70 kDa protein 2; heat shock 70kDa protein 1A; Heat shock protein 2; heat shock protein 70; Heat shock protein 70.2; Heat shock related 70 kDa protein 2; Heat shock-related 70 kDa protein 2; Heat-shock protein, 70-KD, 2; Heat-shock protein, 70-KD, 3; HSP70 2; HSP70 3; Hsp70-2; HSP70-3; HSP70.2; HSP70A2; HSP72; HSP72_HUMAN; HSPA2; Hspt70; Hst70; MGC58299; MGC7795; MGC93458; OTTHUMP00000180664; Testis-specific heat shock protein-related; XXbac BCX40G17.3 001 antibody; heat shock 70kDa protein 2
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
70,021 Da
OMIM
140560
3D Structure
ModBase 3D Structure for P54652
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-HSPA2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-HSPA2 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-HSPA2 antibody

Anti- HSPA2 Picoband antibody, MBS177867, Western blotting
All lanes: Anti HSPA2 (MBS177867) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Thymus Tissue Lysate at 50ug
Lane 3: Rat Testis Tissue Lysate at 50ug
Lane 4: Mouse Liver Tissue Lysate at 50ug
Lane 5: Mouse Kidney Tissue Lysate at 50ug
Lane 6: HELA Whole Cell Lysate at 40ug
Lane 7: MCF-7 Whole Cell Lysate at 40ug
Lane 8: A375 Whole Cell Lysate at 40ug
Lane 9: NIH3T3 Whole Cell Lysate at 40ug
Predicted bind size: 70KD
Observed bind size: 70KD
Anti-HSPA2 Polyclonal Antibody – Cat# MBS177867

Immunohistochemistry (IHC) of anti-HSPA2 antibody

Anti- HSPA2 Picoband antibody, MBS177867,IHC(P)
IHC(P): Mouse Intestine Tissue
Anti-HSPA2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177867

Immunohistochemistry (IHC) of anti-HSPA2 antibody

Anti- HSPA2 Picoband antibody, MBS177867,IHC(P)
IHC(P): Rat Intestine Tissue
Anti-HSPA2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177867

Immunohistochemistry (IHC) of anti-HSPA2 antibody

Anti- HSPA2 Picoband antibody, MBS177867,IHC(P)
IHC(P): Human Lung Cancer Tissue
Anti-HSPA2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177867

Product References and Citations for anti-HSPA2 antibody

1. Bonnycastle, L. L. C., Yu, C.-E., Hunt, C. R., Trask, B. J., Clancy, K. P., Weber, J. L., Patterson, D., Schellenberg, G. D. Cloning, sequencing, and mapping of the human chromosome 14 heat shock protein gene (HSPA2). Genomics 23: 85-93, 1994. 2. Dix, D. J., Allen, J. W., Collins, B. W., Mori, C., Nakamura, N., Poorman-Allen, P., Goulding, E. H., Eddy, E. M. Targeted gene disruption of Hsp70-2 results in failed meiosis, germ cell apoptosis, and male infertility. Proc. Nat. Acad. Sci. 93: 3264-3268, 1996. 3. Hunt, C. R., Gasser, D. L., Chaplin, D. D., Pierce, J. C., Kozak, C. A. Chromosomal localization of five murine HSP70 gene family members: Hsp70-1, Hsp70-2, Hsp70-3, Hsc70t and Grp78. Genomics 16: 193-198, 1993.

Other Notes

Small volumes of anti-HSPA2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HSPA2 purchase

MBS177867 is an antibody targeting HSPA2. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for HSPA2. It may not necessarily be applicable to this product.

NCBI GI #
13676857
NCBI GeneID
3306
NCBI Accession #
NP_068814.2
UniProt Primary Accession #
P54652
UniProt Secondary Accession #
Q15508; Q53XM3; Q9UE78
UniProt Related Accession #
P54652
GenBank Nucleotide #
NM_021979.3
NCBI Official Full Name
heat shock-related 70 kDa protein 2
NCBI Official Synonym Full Names
heat shock protein family A (Hsp70) member 2
NCBI Official Symbol
HSPA2
NCBI Official Synonym Symbols
HSP70-2; HSP70-3
UniProt Protein Name
Heat shock-related 70 kDa protein 2
Protein Family
Heat shock-related 70 kDa protein
UniProt Gene Name
HSPA2
UniProt Synonym Gene Names
Heat shock 70 kDa protein 2
UniProt Entry Name
HSP72_HUMAN
NCBI Protein Information
heat shock-related 70 kDa protein 2

UniProt Comments for HSPA2

HSPA2: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. Interacts with ZNF541. Component of the CatSper complex. Belongs to the heat shock protein 70 family.

Protein type: Chaperone; Heat shock protein

Chromosomal Location of Human Ortholog: 14q24.1

Cellular Component: cell surface; cytosol; male germ cell nucleus; membrane; mitochondrion; myelin sheath; nucleus; synaptonemal complex

Molecular Function: ATP binding; enzyme binding; glycolipid binding; protein binding; unfolded protein binding

Biological Process: G2/M-specific positive regulation of cyclin-dependent protein kinase activity; male meiosis; male meiosis I; protein refolding; response to cold; response to heat; response to unfolded protein; spermatid development; spermatogenesis
Show more

Research Articles on HSPA2

1. we consider the evidence supporting the role of HSPA2 in sperm function and explore the potential mechanisms by which it is depleted in the spermatozoa of infertile patients--{REVIEW}

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-HSPA2 antibody

 Products by Pathway  Pathway Diagram
 Antigen Processing And Presentation Pathway antibodies  Antigen Processing And Presentation Pathway Diagram
 Antigen Processing And Presentation Pathway antibodies  Antigen Processing And Presentation Pathway Diagram
 Attenuation Phase Pathway antibodies  Attenuation Phase Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cellular Response To Heat Stress Pathway antibodies  Cellular Response To Heat Stress Pathway Diagram
 Cellular Responses To Stress Pathway antibodies  Cellular Responses To Stress Pathway Diagram
 Endocytosis Pathway antibodies  Endocytosis Pathway Diagram
 Endocytosis Pathway antibodies  Endocytosis Pathway Diagram
 Epstein-Barr Virus Infection Pathway antibodies  Epstein-Barr Virus Infection Pathway Diagram
 Epstein-Barr Virus Infection Pathway antibodies  Epstein-Barr Virus Infection Pathway Diagram

Diseases associated with anti-HSPA2 antibody

 Disease Name  Pubmed Publications
 Infertility, Male Antibodies  >33 publications with HSPA2 and Infertility, Male
 Necrosis Antibodies  >11 publications with HSPA2 and Necrosis
 Adenocarcinoma Antibodies  >8 publications with HSPA2 and Adenocarcinoma
 Cardiovascular Diseases Antibodies  >6 publications with HSPA2 and Cardiovascular Diseases
 Liver Diseases Antibodies  >5 publications with HSPA2 and Liver Diseases
 Liver Neoplasms Antibodies  >5 publications with HSPA2 and Liver Neoplasms
 Inflammation Antibodies  >5 publications with HSPA2 and Inflammation
 Oligospermia Antibodies  >5 publications with HSPA2 and Oligospermia
 Nervous System Diseases Antibodies  >5 publications with HSPA2 and Nervous System Diseases
 Carcinoma, Hepatocellular Antibodies  >4 publications with HSPA2 and Carcinoma, Hepatocellular

Organs/Tissues associated with anti-HSPA2 antibody

 Organ/Tissue Name  Pubmed Publications
 Testis Antibodies  >57 publications with HSPA2 and Testis
 Blood Antibodies  >16 publications with HSPA2 and Blood
 Brain Antibodies  >10 publications with HSPA2 and Brain
 Muscle Antibodies  >8 publications with HSPA2 and Muscle
 Liver Antibodies  >8 publications with HSPA2 and Liver
 Lung Antibodies  >7 publications with HSPA2 and Lung
 Prostate Antibodies  >7 publications with HSPA2 and Prostate
 Kidney Antibodies  >5 publications with HSPA2 and Kidney
 Esophagus Antibodies  >3 publications with HSPA2 and Esophagus
 Intestine Antibodies  >3 publications with HSPA2 and Intestine
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000