• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

KV1.4 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177914

Description: Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 4(KCNA4) detection. Tested with WB, IHC-P in Human.Background: Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, is a protein… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Kv1.4, Polyclonal Antibody
Full Product Name
Anti-Kv1.4 Antibody
Product Gene Name
anti-Kv1.4 antibody
Product Synonym Names
Potassium voltage-gated channel subfamily A member 4; Voltage gated K+ channel HuKII; cardiac potassium channel; fetal skeletal muscle potassium channel; HBK 4; HBK4; HK 1; HK1; HPCN 2; HPCN2; HUK II; HUKII; KCNA 4; KCNA 8; KCNA4; KCNA4_HUMAN; KCNA4L; KCNA8; kv1.4; PCN 2; PCN2; potassium channel 2; potassium channel KCNA4; potassium channel protein; Potassium voltage gated channel shaker related subfamily member 4; Potassium voltage gated channel subfamily A member 4; potassium voltage-gated channel shaker-related subfamily member 4-like; Potassium voltage-gated channel subfamily A member 4; rapidly inactivating potassium channel; Shaker related potassium channel Kv1.4; shaker-related potassium channel Kv1.4; type A potassium channel; Voltage gated potassium channel HBK4; Voltage gated potassium channel HK1; Voltage gated potassium channel subunit Kv1.4; Voltage-gated K(+) channel HuKII; voltage-gated potassium channel; Voltage-gated potassium channel HBK4; Voltage-gated potassium channel HK1; voltage-gated potassium channel protein Kv1.4; Voltage-gated potassium channel subunit Kv1.4 antibody; potassium voltage-gated channel, shaker-related subfamily, member 4
Clonality
Polyclonal
Species Reactivity
Human
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
73,257 Da
OMIM
176266
3D Structure
ModBase 3D Structure for P22459
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.4 (609-647aa SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-Kv1.4 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-Kv1.4 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-Kv1.4 antibody

Anti- Kv1.4 Picoband antibody, MBS177914, Western blotting
All lanes: Anti Kv1.4 (MBS177914) at 0.5ug/ml
Lane 1: HELA Whole Cell Lysate at 40ug
Lane 2: COLO320 Whole Cell Lysate at 40ug
Lane 3: HT1080 Whole Cell Lysate at 40ug
Lane 4: PANC Whole Cell Lysate at 40ug
Predicted bind size: 73KD
Observed bind size: 73KD
Anti-KV1.4 Polyclonal Antibody – Cat# MBS177914

Immunohistochemistry (IHC) of anti-Kv1.4 antibody

Anti- Kv1.4 Picoband antibody, MBS177914, IHC(P)
IHC(P): Human Lung Cancer Tissue
Anti-KV1.4 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177914

Product References and Citations for anti-Kv1.4 antibody

1. "Entrez Gene: KCNA4 potassium voltage-gated channel, shaker-related subfamily, member 4". 2. Gutman GA, Chandy KG, Grissmer S, Lazdunski M, McKinnon D, Pardo LA, Robertson GA, Rudy B, Sanguinetti MC, Stuhmer W, Wang X (Dec 2005). "International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels". Pharmacol Rev 57 (4): 473-508. 3. Philipson LH, Schaefer K, LaMendola J, Bell GI, Steiner DF (Feb 1991)."Sequence of a human fetal skeletal muscle potassium channel cDNA related to RCK4". Nucleic Acids Res 18 (23): 7160.

Other Notes

Small volumes of anti-Kv1.4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for Kv1.4 purchase

MBS177914 is an antibody targeting Kv1.4. Reactive in Human.

Additional Details

NCBI/Uniprot data below describe general gene information for Kv1.4. It may not necessarily be applicable to this product.

NCBI GI #
4504817
NCBI GeneID
3739
NCBI Accession #
NP_002224.1
UniProt Primary Accession #
P22459
UniProt Related Accession #
P22459
GenBank Nucleotide #
NM_002233.3
NCBI Official Full Name
potassium voltage-gated channel subfamily A member 4
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily A member 4
NCBI Official Symbol
KCNA4
NCBI Official Synonym Symbols
HK1; HBK4; PCN2; HPCN2; HUKII; KCNA8; KV1.4; KCNA4L
UniProt Protein Name
Potassium voltage-gated channel subfamily A member 4
UniProt Synonym Protein Names
HPCN2; Voltage-gated K(+) channel HuKII
Protein Family
Potassium voltage-gated channel subfamily
UniProt Gene Name
KCNA4
UniProt Synonym Gene Names
KCNA4L
UniProt Entry Name
KCNA4_HUMAN
NCBI Protein Information
potassium voltage-gated channel subfamily A member 4

NCBI Summary for Kv1.4

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influence the duration of cardiac action potential.[provided by RefSeq, Mar 2011]
Show more

UniProt Comments for Kv1.4

Kv1.4: Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.4/KCNA4 sub-subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, potassium

Chromosomal Location of Human Ortholog: 11p14

Cellular Component: axon; integral to membrane; integral to plasma membrane; plasma membrane; voltage-gated potassium channel complex

Molecular Function: delayed rectifier potassium channel activity; potassium ion binding; protein binding; voltage-gated potassium channel activity

Biological Process: potassium ion transport; protein homooligomerization
Show more

Research Articles on Kv1.4

1. Expression of Kv1.4 appears to increase in the spinal cord of mice modelling remitting-relapsing experimental allergic encephalomyelitis (rrEAE) in peak and remitting phases.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-Kv1.4 antibody

 Reference Product  PubMed Publications
 KCNA5 antibody  >25 publications with Kv1.4 and KCNA5
 KCNA2 antibody  >22 publications with Kv1.4 and KCNA2
 KCNAB1 antibody  >4 publications with Kv1.4 and KCNAB1
 DLG1 antibody  >3 publications with Kv1.4 and DLG1
 KCNH2 antibody  >2 publications with Kv1.4 and KCNH2
 KCNH6 antibody  >1 publications with Kv1.4 and KCNH6
 KCNAB2 antibody  >1 publications with Kv1.4 and KCNAB2

Pathways associated with anti-Kv1.4 antibody

 Products by Pathway  Pathway Diagram
 Neuronal System Pathway antibodies  Neuronal System Pathway Diagram
 Potassium Channels Pathway antibodies  Potassium Channels Pathway Diagram
 Voltage Gated Potassium Channels Pathway antibodies  Voltage Gated Potassium Channels Pathway Diagram

Diseases associated with anti-Kv1.4 antibody

 Disease Name  Pubmed Publications
 Cardiovascular Diseases Antibodies  >14 publications with Kv1.4 and Cardiovascular Diseases
 Heart Diseases Antibodies  >14 publications with Kv1.4 and Heart Diseases
 Brain Diseases Antibodies  >5 publications with Kv1.4 and Brain Diseases
 Disease Models, Animal Antibodies  >5 publications with Kv1.4 and Disease Models, Animal
 Pain Antibodies  >4 publications with Kv1.4 and Pain
 Cardiomegaly Antibodies  >3 publications with Kv1.4 and Cardiomegaly
 Myocardial Infarction Antibodies  >3 publications with Kv1.4 and Myocardial Infarction
 Inflammation Antibodies  >3 publications with Kv1.4 and Inflammation
 Fibrosis Antibodies  >2 publications with Kv1.4 and Fibrosis
 Neurobehavioral Manifestations Antibodies  >2 publications with Kv1.4 and Neurobehavioral Manifestations

Organs/Tissues associated with anti-Kv1.4 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >41 publications with Kv1.4 and Brain
 Lung Antibodies  >2 publications with Kv1.4 and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000