• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

BMP2 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177931

Description: Rabbit IgG polyclonal antibody for Bone morphogenetic protein 2(BMP2) detection. Tested with WB, IHC-P, ELISA in Human;Rat.Background: BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
BMP2, Polyclonal Antibody
Full Product Name
Anti-BMP2 Antibody
Product Gene Name
anti-BMP2 antibody
Product Synonym Names
Bone morphogenetic protein 2; BDA2; BMP-2; BMP-2A; Bmp2; BMP2_HUMAN; BMP2A; Bone morphogenetic protein 2; Bone morphogenetic protein 2A; bone morphogenetic protein 2
Clonality
Polyclonal
Species Reactivity
Human, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
44,702 Da
OMIM
112261
3D Structure
ModBase 3D Structure for P12643
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-BMP2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA)
Application Notes for anti-BMP2 antibody
ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-BMP2 antibody

Anti- BMP-2 Picoband antibody, MBS177931, Western blotting
All lanes: Anti BMP-2 (MBS177931) at 0.5ug/ml
Lane 1: Rat Lung Tissue Lysate at 50ug
Lane 2: Rat Brain Tissue Lysate at 50ug
Lane 3: U87 Whole Cell Lysate at 40ug
Lane 4: HELA Whole Cell Lysate at 40ug
Predicted bind size: 45KD
Observed bind size: 20 KD, 40KD
Anti-BMP2 Polyclonal Antibody – Cat# MBS177931

Immunohistochemistry (IHC) of anti-BMP2 antibody

Anti- BMP-2 Picoband antibody, MBS177931, IHC(P)
IHC(P): Human Intestinal Cancer Tissue
Anti-BMP2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177931

Product References and Citations for anti-BMP2 antibody

1. Gopal Rao, V. V. N., Loffler, C., Wozney, J. M., Hansmann, I. The gene for bone morphogenetic protein 2A (BMP2A) is localized to human chromosome 20p12 by radioactive and nonradioactive in situ hybridization. Hum. Genet. 90: 299-302, 1992.  2. Kaplan, F. S., Tabas, J. A., Zasloff, M. A. Fibrodysplasia ossificans progressiva: a clue from the fly? Calcif. Tissue Int. 47: 117-125, 1990.  3. Sampath TK, Coughlin JE, Whetstone RM, Banach D, Corbett C, Ridge RJ, Ozkaynak E, Oppermann H, Rueger DC (August 1990)."Bovine osteogenic protein is composed of dimers of OP-1 and BMP-2A, two members of the transforming growth factor-beta superfamily". J. Biol. Chem. 265 (22): 13198-205.

Other Notes

Small volumes of anti-BMP2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for BMP2 purchase

MBS177931 is an antibody targeting BMP2. Reactive in Human, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for BMP2. It may not necessarily be applicable to this product.

NCBI GI #
4557369
NCBI GeneID
650
NCBI Accession #
NP_001191.1
UniProt Primary Accession #
P12643
UniProt Related Accession #
P12643
GenBank Nucleotide #
NM_001200.3
NCBI Official Full Name
bone morphogenetic protein 2 preproprotein
NCBI Official Synonym Full Names
bone morphogenetic protein 2
NCBI Official Symbol
BMP2
NCBI Official Synonym Symbols
BDA2; BMP2A
UniProt Protein Name
Bone morphogenetic protein 2
UniProt Synonym Protein Names
Bone morphogenetic protein 2A; BMP-2A
Protein Family
Bone morphogenetic protein
UniProt Gene Name
BMP2
UniProt Synonym Gene Names
BMP2A; BMP-2; BMP-2A
UniProt Entry Name
BMP2_HUMAN
NCBI Protein Information
bone morphogenetic protein 2

NCBI Summary for BMP2

This gene encodes a member of the transforming growth factor-beta (TGFB) superfamily. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer, which induces bone and cartilage formation. [provided by RefSeq, Nov 2015]

UniProt Comments for BMP2

Induces cartilage and bone formation (PubMed:3201241). Stimulates the differentiation of myoblasts into osteoblasts via the EIF2AK3-EIF2A- ATF4 pathway. BMP2 activation of EIF2AK3 stimulates phosphorylation of EIF2A which leads to increased expression of ATF4 which plays a central role in osteoblast differentiation. In addition stimulates TMEM119, which upregulates the expression of ATF4 (PubMed:24362451).
Show more

Research Articles on BMP2

1. ovariectomy and corticosteroid-induced osteoporosis significantly undermines rhBMP-2 osteoinductivity.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-BMP2 antibody

 Reference Product  PubMed Publications
 BMPR2 antibody  >232 publications with BMP2 and BMPR2
 SMAD5 antibody  >120 publications with BMP2 and SMAD5
 BMPR1A antibody  >107 publications with BMP2 and BMPR1A
 SMAD4 antibody  >104 publications with BMP2 and SMAD4
 BMPR1B antibody  >71 publications with BMP2 and BMPR1B
 SMAD6 antibody  >69 publications with BMP2 and SMAD6
 NOG antibody  >14 publications with BMP2 and NOG
 ACVR2B antibody  >9 publications with BMP2 and ACVR2B
 ACVR2A antibody  >6 publications with BMP2 and ACVR2A
 CHRD antibody  >4 publications with BMP2 and CHRD

Pathways associated with anti-BMP2 antibody

 Products by Pathway  Pathway Diagram
 Adipogenesis Pathway antibodies  Adipogenesis Pathway Diagram
 BDNF Signaling Pathway antibodies  BDNF Signaling Pathway Diagram
 BMP Signaling Pathway antibodies  BMP Signaling Pathway Diagram
 BMP Signaling Pathway antibodies  BMP Signaling Pathway Diagram
 BMP Signalling And Regulation Pathway antibodies  BMP Signalling And Regulation Pathway Diagram
 Basal Cell Carcinoma Pathway antibodies  Basal Cell Carcinoma Pathway Diagram
 Basal Cell Carcinoma Pathway antibodies  Basal Cell Carcinoma Pathway Diagram
 Cytokine-cytokine Receptor Interaction Pathway antibodies  Cytokine-cytokine Receptor Interaction Pathway Diagram
 Cytokine-cytokine Receptor Interaction Pathway antibodies  Cytokine-cytokine Receptor Interaction Pathway Diagram
 Elastic Fibre Formation Pathway antibodies  Elastic Fibre Formation Pathway Diagram

Diseases associated with anti-BMP2 antibody

 Disease Name  Pubmed Publications
 Bone Diseases Antibodies  >650 publications with BMP2 and Bone Diseases
 Necrosis Antibodies  >131 publications with BMP2 and Necrosis
 Inflammation Antibodies  >121 publications with BMP2 and Inflammation
 Lung Diseases Antibodies  >58 publications with BMP2 and Lung Diseases
 Hypertrophy Antibodies  >54 publications with BMP2 and Hypertrophy
 Pain Antibodies  >53 publications with BMP2 and Pain
 Hypertension Antibodies  >50 publications with BMP2 and Hypertension
 Kidney Diseases Antibodies  >44 publications with BMP2 and Kidney Diseases
 Fibrosis Antibodies  >40 publications with BMP2 and Fibrosis
 Breast Neoplasms Antibodies  >36 publications with BMP2 and Breast Neoplasms

Organs/Tissues associated with anti-BMP2 antibody

 Organ/Tissue Name  Pubmed Publications
 Bone Antibodies  >4647 publications with BMP2 and Bone
 Connective Tissue Antibodies  >702 publications with BMP2 and Connective Tissue
 Embryonic Tissue Antibodies  >467 publications with BMP2 and Embryonic Tissue
 Heart Antibodies  >209 publications with BMP2 and Heart
 Brain Antibodies  >171 publications with BMP2 and Brain
 Kidney Antibodies  >111 publications with BMP2 and Kidney
 Lung Antibodies  >93 publications with BMP2 and Lung
 Liver Antibodies  >76 publications with BMP2 and Liver
 Eye Antibodies  >66 publications with BMP2 and Eye
 Uterus Antibodies  >34 publications with BMP2 and Uterus
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000