• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Aquaporin 1 (AQP1) Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177933

Description: Rabbit IgG polyclonal antibody for Aquaporin-1(AQP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Background: Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Aquaporin 1 (AQP1), Polyclonal Antibody
Full Product Name
Anti-Aquaporin 1 Antibody
Product Gene Name
anti-AQP1 antibody
Product Synonym Names
Aquaporin-1; AQP 1; AQP CHIP; AQP-1; AQP1; AQP1_HUMAN; Aquaporin CHIP; Aquaporin-1; Aquaporin-CHIP; Aquaporin1; Channel forming integral protein 28kDa; Channel like integral membrane protein 28 kDa; CHIP 28; CHIP28; CO; Colton blood group; Growth factor induced delayed early response protein; MGC26324; Urine water channel; Water channel protein CHIP 29; Water channel protein CHIP29; Water channel protein for red blood cells and kidney proximal tubule; aquaporin 1
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
16,677 Da
OMIM
107776
3D Structure
ModBase 3D Structure for P29972
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-AQP1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-AQP1 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-AQP1 antibody

Anti- Aquaporin 1 Picoband antibody, MBS177933, Western blotting
All lanes: Anti Aquaporin 1 (MBS177933) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Rat Lung Tissue Lysate at 50ug
Lane 3: Rat Cardiac Muscle Tissue Lysate at 50ug
Lane 4: PC-12 Whole Cell Lysate at 40ug
Lane 5: HEPA Whole Cell Lysate at 40ug
Predicted bind size: 29KD
Observed bind size: 29KD
Anti-AQP1 Polyclonal Antibody – Cat# MBS177933

Immunohistochemistry (IHC) of anti-AQP1 antibody

Anti- Aquaporin 1 Picoband antibody, MBS177933, IHC(P)
IHC(P): Mouse Kidney Tissue
Anti-AQP1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177933

Immunohistochemistry (IHC) of anti-AQP1 antibody

Anti- Aquaporin 1 Picoband antibody, MBS177933, IHC(P)
IHC(P): Rat Kidney Tissue
Anti-AQP1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177933

Immunohistochemistry (IHC) of anti-AQP1 antibody

Anti- Aquaporin 1 Picoband antibody, MBS177933, IHC(P)
IHC(P): Human Intestinal Cancer Tissue
Anti-AQP1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177933

Product References and Citations for anti-AQP1 antibody

1. Denker, B. M.; Smith, B. L.; Kuhajda, F. P.; Agre, P. : Identification, purification, and partial characterization of a novel M(r) 28,000 integral membrane protein from erythrocytes and renal tubules. J. Biol. Chem. 263: 15634-15642, 1988. 2. Thiagarajah, J. R.; Verkman, A. S. : Aquaporin deletion in mice reduces corneal water permeability and delays restoration of transparency after swelling. J. Biol. Chem. 277: 19139-19144, 2002.

Other Notes

Small volumes of anti-AQP1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for AQP1 purchase

MBS177933 is an antibody targeting AQP1. Also known as Anti-Aquaporin 1 Antibody. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for AQP1. It may not necessarily be applicable to this product.

NCBI GI #
297307116
NCBI GeneID
358
NCBI Accession #
NP_001171989.1
UniProt Primary Accession #
P29972
UniProt Secondary Accession #
Q8TBI5; Q8TDC1; B5BU39; E7EM69; E9PC21; F5GY19
UniProt Related Accession #
P29972
GenBank Nucleotide #
NM_001185060.1
NCBI Official Full Name
aquaporin-1 isoform 2
NCBI Official Synonym Full Names
aquaporin 1 (Colton blood group)
NCBI Official Symbol
AQP1
NCBI Official Synonym Symbols
CO; CHIP28; AQP-CHIP
UniProt Protein Name
Aquaporin-1
UniProt Synonym Protein Names
Aquaporin-CHIP; Urine water channel; Water channel protein for red blood cells and kidney proximal tubule
Protein Family
Aquaporin
UniProt Gene Name
AQP1
UniProt Synonym Gene Names
CHIP28; AQP-1
UniProt Entry Name
AQP1_HUMAN
NCBI Protein Information
aquaporin-1

NCBI Summary for AQP1

Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). This gene encodes an aquaporin which functions as a molecular water channel protein. It is a homotetramer with 6 bilayer spanning domains and N-glycosylation sites. The protein physically resembles channel proteins and is abundant in erythrocytes and renal tubes. The gene encoding this aquaporin is a possible candidate for disorders involving imbalance in ocular fluid movement. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
Show more

UniProt Comments for AQP1

AQP1: Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Belongs to the MIP/aquaporin (TC 1.A.8) family.

Protein type: Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, aquaporin family

Chromosomal Location of Human Ortholog: 7p14

Cellular Component: apical part of cell; apical plasma membrane; basal plasma membrane; basolateral plasma membrane; brush border; brush border membrane; cytoplasm; integral to plasma membrane; nuclear membrane; nucleus; plasma membrane; sarcolemma

Molecular Function: ammonium transmembrane transporter activity; glycerol channel activity; glycerol transmembrane transporter activity; intracellular cGMP activated cation channel activity; nitric oxide transporter activity; potassium channel activity; potassium ion transmembrane transporter activity; protein binding; transmembrane transporter activity; water channel activity; water transporter activity

Biological Process: ammonium transport; bicarbonate transport; carbon dioxide transport; cell volume homeostasis; cellular homeostasis; cellular response to stress; cellular water homeostasis; cerebrospinal fluid secretion; cGMP biosynthetic process; establishment and/or maintenance of actin cytoskeleton polarity; glycerol transport; lateral ventricle development; multicellular organismal water homeostasis; negative regulation of apoptosis; negative regulation of caspase activity; nitric oxide transport; odontogenesis; pancreatic juice secretion; positive regulation of angiogenesis; positive regulation of fibroblast proliferation; positive regulation of saliva secretion; potassium ion transport; renal water homeostasis; renal water transport; response to drug; water transport

Disease: Blood Group--colton
Show more

Research Articles on AQP1

1. The results suggest that AQP1 may facilitate lung cancer cell proliferation and migration in an MMP-2 and-9-dependent manner

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-AQP1 antibody

 Reference Product  PubMed Publications
 AQP2 antibody  >266 publications with AQP1 and AQP2
 TNF antibody  >19 publications with AQP1 and TNF
 AVP antibody  >19 publications with AQP1 and AVP
 HBB antibody  >2 publications with AQP1 and HBB
 UHMK1 antibody  >1 publications with AQP1 and UHMK1

Pathways associated with anti-AQP1 antibody

 Products by Pathway  Pathway Diagram
 Aquaporin-mediated Transport Pathway antibodies  Aquaporin-mediated Transport Pathway Diagram
 Bile Secretion Pathway antibodies  Bile Secretion Pathway Diagram
 Bile Secretion Pathway antibodies  Bile Secretion Pathway Diagram
 Erythrocytes Take Up Carbon Dioxide And Release Oxygen Pathway antibodies  Erythrocytes Take Up Carbon Dioxide And Release Oxygen Pathway Diagram
 Erythrocytes Take Up Oxygen And Release Carbon Dioxide Pathway antibodies  Erythrocytes Take Up Oxygen And Release Carbon Dioxide Pathway Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 O2/CO2 Exchange In Erythrocytes Pathway antibodies  O2/CO2 Exchange In Erythrocytes Pathway Diagram
 Passive Transport By Aquaporins Pathway antibodies  Passive Transport By Aquaporins Pathway Diagram
 Proximal Tubule Bicarbonate Reclamation Pathway antibodies  Proximal Tubule Bicarbonate Reclamation Pathway Diagram
 Proximal Tubule Bicarbonate Reclamation Pathway antibodies  Proximal Tubule Bicarbonate Reclamation Pathway Diagram

Diseases associated with anti-AQP1 antibody

 Disease Name  Pubmed Publications
 Edema Antibodies  >181 publications with AQP1 and Edema
 Kidney Diseases Antibodies  >133 publications with AQP1 and Kidney Diseases
 Disease Models, Animal Antibodies  >117 publications with AQP1 and Disease Models, Animal
 Nervous System Diseases Antibodies  >111 publications with AQP1 and Nervous System Diseases
 Carcinoma Antibodies  >55 publications with AQP1 and Carcinoma
 Inflammation Antibodies  >49 publications with AQP1 and Inflammation
 Fibrosis Antibodies  >45 publications with AQP1 and Fibrosis
 Hypertension Antibodies  >36 publications with AQP1 and Hypertension
 Liver Diseases Antibodies  >30 publications with AQP1 and Liver Diseases
 Adenocarcinoma Antibodies  >29 publications with AQP1 and Adenocarcinoma

Organs/Tissues associated with anti-AQP1 antibody

 Organ/Tissue Name  Pubmed Publications
 Kidney Antibodies  >411 publications with AQP1 and Kidney
 Brain Antibodies  >215 publications with AQP1 and Brain
 Vascular Antibodies  >201 publications with AQP1 and Vascular
 Lung Antibodies  >167 publications with AQP1 and Lung
 Eye Antibodies  >145 publications with AQP1 and Eye
 Muscle Antibodies  >72 publications with AQP1 and Muscle
 Heart Antibodies  >64 publications with AQP1 and Heart
 Liver Antibodies  >64 publications with AQP1 and Liver
 Mouth Antibodies  >57 publications with AQP1 and Mouth
 Intestine Antibodies  >51 publications with AQP1 and Intestine
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000