• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GRP75 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177947

Description: Rabbit IgG polyclonal antibody for Stress-70 protein, mitochondrial(HSPA9) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Background: HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Grp75, Polyclonal Antibody
Full Product Name
Anti-Grp75 Antibody
Product Gene Name
anti-Grp75 antibody
Product Synonym Names
Stress-70 protein; 75 kDa glucose regulated protein; 75 kDa glucose-regulated protein; CSA; Glucose Regulated Protein; Grp 75; GRP-75; GRP75; GRP75_HUMAN; Heat shock 70 kDa protein 9; Heat shock 70kD protein 9; heat shock 70kDa protein 9; Heat shock 70kDa protein 9B; Heat shock protein 74 kDa A; Heat shock protein A; Heat shock protein cognate 74; Hsc74; Hsp74; Hsp74a; HSPA9; Hspa9a; HSPA9B; MGC4500; mitochondrial; Mortalin 2; Mortalin; Mortalin perinuclear; Mortalin2; MOT 2; MOT; MOT2; Mthsp70; p66 mortalin; P66 MOT; PBP74; Peptide binding protein 74; Peptide-binding protein 74; Stress 70 protein mitochondrial; Stress 70 protein mitochondrial precursor; Stress-70 protein antibody; heat shock 70kDa protein 9 (mortalin)
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
73,680 Da
OMIM
600548
3D Structure
ModBase 3D Structure for P38646
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-Grp75 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-Grp75 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-Grp75 antibody

Anti- Grp75 Picoband antibody, MBS177947, Western blotting
All lanes: Anti Grp75 (MBS177947) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Rat Thymus Tissue Lysate at 50ug
Lane 3: Rat Testis Tissue Lysate at 50ug
Lane 4: Mouse Liver Tissue Lysate at 50ug
Lane 5: Mouse Thymus Tissue Lysate at 50ug
Lane 6: Mouse Testis Tissue Lysate at 50ug
Lane 7: HELA Whole Cell Lysate at 40ug
Lane 8: MCF-7 Whole Cell Lysate at 40ug
Lane 9: SW620 Whole Cell Lysate at 40ug
Lane 10: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 74KD
Observed bind size: 74KD
Anti-GRP75 Polyclonal Antibody – Cat# MBS177947

Immunohistochemistry (IHC) of anti-Grp75 antibody

Anti- Grp75 Picoband antibody, MBS177947,IHC(P)
IHC(P): Mouse Kidney Tissue
Anti-GRP75 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177947

Immunohistochemistry (IHC) of anti-Grp75 antibody

Anti- Grp75 Picoband antibody, MBS177947,IHC(P)
IHC(P): Rat Kidney Tissue
Anti-GRP75 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177947

Immunohistochemistry (IHC) of anti-Grp75 antibody

Anti- Grp75 Picoband antibody, MBS177947,IHC(P)
IHC(P): Human Intestinal Cancer Tissue
Anti-GRP75 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177947

Product References and Citations for anti-Grp75 antibody

1. Chen, T. H.-P., Kambal, A., Krysiak, K., Walshauser, M. A., Raju, G., Tibbitts, J. F., Walter, M. J. Knockdown of Hspa9, a del(5q31.2) gene, results in a decrease in hematopoietic progenitors in mice. Blood 117: 1530-1539, 2011. 2. Gross, M. B. Personal Communication. Baltimore, Md. 9/12/2011. 3. Kaul, S. C., Wadhwa, R., Matsuda, Y., Hensler, P. J., Pereira-Smith, O. M., Komatsu, Y., Mitsui, Y. Mouse and human chromosomal assignments of mortalin, a novel member of the murine hsp70 family of proteins. FEBS Lett. 361: 269-272, 1995.

Other Notes

Small volumes of anti-Grp75 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for Grp75 purchase

MBS177947 is an antibody targeting Grp75. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for Grp75. It may not necessarily be applicable to this product.

NCBI GI #
24234688
NCBI GeneID
3313
NCBI Accession #
NP_004125.3
UniProt Primary Accession #
P38646
UniProt Secondary Accession #
P30036; P31932; Q1HB43; Q53H23; Q6GU03; Q9BWB7; Q9UC56; B2RCM1
UniProt Related Accession #
P38646
GenBank Nucleotide #
NM_004134.6
NCBI Official Full Name
stress-70 protein, mitochondrial
NCBI Official Synonym Full Names
heat shock protein family A (Hsp70) member 9
NCBI Official Symbol
HSPA9
NCBI Official Synonym Symbols
CSA; MOT; MOT2; SAAN; CRP40; EVPLS; GRP75; PBP74; GRP-75; HSPA9B; SIDBA4; MTHSP75; HEL-S-124m
UniProt Protein Name
Stress-70 protein, mitochondrial
UniProt Synonym Protein Names
75 kDa glucose-regulated protein; GRP-75; Heat shock 70 kDa protein 9; Mortalin; MOT; Peptide-binding protein 74; PBP74
UniProt Gene Name
HSPA9
UniProt Synonym Gene Names
GRP75; HSPA9B; mt-HSP70; GRP-75; MOT; PBP74
UniProt Entry Name
GRP75_HUMAN
NCBI Protein Information
stress-70 protein, mitochondrial

NCBI Summary for Grp75

This gene encodes a member of the heat shock protein 70 gene family. The encoded protein is primarily localized to the mitochondria but is also found in the endoplasmic reticulum, plasma membrane and cytoplasmic vesicles. This protein is a heat-shock cognate protein. This protein plays a role in cell proliferation, stress response and maintenance of the mitochondria. A pseudogene of this gene is found on chromosome 2.[provided by RefSeq, May 2010]
Show more

UniProt Comments for Grp75

HSPA9B: Implicated in the control of cell proliferation and cellular aging. May also act as a chaperone. Interacts with FXN. Interacts with HSCB. Component of the MINOS/MitOS complex, that includes IMMT, HSPA9 and CHCHD3 and associates with mitochondrial outer membrane proteins SAMM50, MTX1 and MTX2. Belongs to the heat shock protein 70 family.

Protein type: Nucleolus; Heat shock protein; Chaperone

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: cytoplasm; focal adhesion; mitochondrion; myelin sheath; nucleolus

Molecular Function: ATP binding; fibroblast growth factor binding; heat shock protein binding; protein binding; ubiquitin protein ligase binding; unfolded protein binding

Biological Process: negative regulation of apoptosis; protein export from nucleus; protein folding; response to toxin
Show more

Research Articles on Grp75

1. mutations in HSPA9 result in congenital sideroblastic anemia inherited as an autosomal recessive trait

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-Grp75 antibody

 Reference Product  PubMed Publications
 TP53 antibody  >8 publications with Grp75 and TP53
 DNLZ antibody  >2 publications with Grp75 and DNLZ
 DNAJA3 antibody  >2 publications with Grp75 and DNAJA3
 UBC antibody  >1 publications with Grp75 and UBC

Pathways associated with anti-Grp75 antibody

 Products by Pathway  Pathway Diagram
 Cellular Response To Heat Stress Pathway antibodies  Cellular Response To Heat Stress Pathway Diagram
 Cellular Responses To Stress Pathway antibodies  Cellular Responses To Stress Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram
 Mitochondrial Protein Import Pathway antibodies  Mitochondrial Protein Import Pathway Diagram
 Parkin-Ubiquitin Proteasomal System Pathway antibodies  Parkin-Ubiquitin Proteasomal System Pathway Diagram
 RNA Degradation Pathway antibodies  RNA Degradation Pathway Diagram
 RNA Degradation Pathway antibodies  RNA Degradation Pathway Diagram
 Regulation Of HSF1-mediated Heat Shock Response Pathway antibodies  Regulation Of HSF1-mediated Heat Shock Response Pathway Diagram
 Tuberculosis Pathway antibodies  Tuberculosis Pathway Diagram
 Tuberculosis Pathway antibodies  Tuberculosis Pathway Diagram

Diseases associated with anti-Grp75 antibody

 Disease Name  Pubmed Publications
 Cell Transformation, Neoplastic Antibodies  >11 publications with Grp75 and Cell Transformation, Neoplastic
 Brain Diseases Antibodies  >10 publications with Grp75 and Brain Diseases
 Nervous System Diseases Antibodies  >10 publications with Grp75 and Nervous System Diseases
 Parkinson Disease Antibodies  >6 publications with Grp75 and Parkinson Disease
 Neoplasms, Experimental Antibodies  >5 publications with Grp75 and Neoplasms, Experimental
 Carcinoma, Hepatocellular Antibodies  >5 publications with Grp75 and Carcinoma, Hepatocellular
 Liver Neoplasms Antibodies  >4 publications with Grp75 and Liver Neoplasms
 Liver Diseases Antibodies  >4 publications with Grp75 and Liver Diseases
 Cardiovascular Diseases Antibodies  >3 publications with Grp75 and Cardiovascular Diseases
 Inflammation Antibodies  >2 publications with Grp75 and Inflammation

Organs/Tissues associated with anti-Grp75 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >11 publications with Grp75 and Blood
 Brain Antibodies  >10 publications with Grp75 and Brain
 Liver Antibodies  >9 publications with Grp75 and Liver
 Bone Antibodies  >7 publications with Grp75 and Bone
 Lung Antibodies  >5 publications with Grp75 and Lung
 Bone Marrow Antibodies  >4 publications with Grp75 and Bone Marrow
 Skin Antibodies  >4 publications with Grp75 and Skin
 Vascular Antibodies  >3 publications with Grp75 and Vascular
 Kidney Antibodies  >2 publications with Grp75 and Kidney
 Pancreas Antibodies  >2 publications with Grp75 and Pancreas
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000