Anti-NUR77 Polyclonal Antibody – Cat# MBS177954

Anti- NUR77 Picoband antibody, MBS177954, Western blotting
All lanes: Anti NUR77 (MBS177954) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Lane 3: U87 Whole Cell Lysate at 40ug
Lane 4: HELA Whole Cell Lysate at 40ug
Predicted bind size: 67KD
Observed bind size: 67KD

NUR77 Antibody – Polyclonal

Name: NUR77 Antibody; Polyclonal; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS177954
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177954

Description: Rabbit IgG polyclonal antibody for Nuclear receptor subfamily 4 group A member 1(NR4A1) detection. Tested with WB in Human;Mouse;Rat.Background: NR4A1 (NUCLEAR RECEPTOR SUBFAMILY 4, GROUP A, MEMBER 1), also called NAK1, GFRP1, TR3, NUR77 or… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

NUR77, Polyclonal Antibody

Full Product Name

Anti-NUR77 Antibody

Product Gene Name

anti-NUR77 antibody

Product Synonym Names

Nuclear receptor subfamily 4 group A member 1; Early response protein NAK1; GFRP 1; GFRP; GFRP1; Growth factor inducible nuclear protein N10; Growth Factor Inducible Nuclear Protein NP10; Growth Factor Response Protein 1; Hbr1; HMR; Hormone Receptor; MGC9485; N10; N10 nuclear protein; NAK 1; NAK1; Nerve growth factor IB nuclear receptor variant 1; NGFIB; NP 10; NP10; NR4A1; NR4A1_HUMAN; Nuclear hormone receptor NUR/77; Nuclear Hormone Receptor TR3; Nuclear Receptor Subfamily 4 Group A Member 1; NUR 77; NUR77; Orphan nuclear receptor HMR; Orphan nuclear receptor NR4A1; Orphan nuclear receptor TR3; ST 59; ST-59; ST59; Steroid receptor TR3; Testicular receptor 3; TR 3; TR3; TR3 orphan receptor antibody; nuclear receptor subfamily 4, group A, member 1

Clonality

Polyclonal

Species Reactivity

Human, Mouse, Rat

Form/Format

Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen Affinity Purified

Preparation and Storage

At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

33,754 Da

OMIM

139139

3D Structure

ModBase 3D Structure for P22736

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human NUR77 (372-408aa HLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Ig Type

Rabbit IgG

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-NUR77 antibody

Western Blot (WB)

Application Notes for anti-NUR77 antibody

Western Blot Concentration: 0.1-0.5ug/ml

Product References and Citations for anti-NUR77 antibody

1. Chang, C., Kokontis, J., Liao, S. S., Chang, Y. Isolation and characterization of human TR3 receptor: a member of steroid receptor superfamily. J. Steroid Biochem. 34: 391-395, 1989. 2. Dequiedt, F., Kasler, H., Fischle, W., Kiermer, V., Weinstein, M., Herndier, B. G., Verdin, E. HDAC7, a thymus-specific class II histone deacetylase, regulates Nur77 transcription and TCR-mediated apoptosis. Immunity 18: 687-698, 2003. 3. Forman, B. M., Umesono, K., Chen, J., Evans, R. M. Unique response pathways are established by allosteric interactions among nuclear hormone receptors. Cell 81: 541-550, 1995.

Other Notes

Small volumes of anti-NUR77 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NUR77 purchase

MBS177954 is an antibody targeting NUR77. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for NUR77. It may not necessarily be applicable to this product.

NCBI GI #

320202956

NCBI GeneID

3164

NCBI Accession #

NP_001189162.1

UniProt Primary Accession #

P22736

UniProt Secondary Accession #

Q15627; Q53Y00; Q6IBU8; B4DML7

UniProt Related Accession #

P22736

GenBank Nucleotide #

NM_001202233.1

NCBI Official Full Name

nuclear receptor subfamily 4 group A member 1 isoform 2

NCBI Official Synonym Full Names

nuclear receptor subfamily 4 group A member 1

NCBI Official Symbol

NR4A1

NCBI Official Synonym Symbols

HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77

UniProt Protein Name

Nuclear receptor subfamily 4 group A member 1

UniProt Synonym Protein Names

Early response protein NAK1; Nuclear hormone receptor NUR/77; Nur77; Orphan nuclear receptor HMR; Orphan nuclear receptor TR3; ST-59; Testicular receptor 3

Protein Family

KH homology domain-containing protein

UniProt Gene Name

NR4A1

UniProt Synonym Gene Names

GFRP1; HMR; NAK1; Nur77

UniProt Entry Name

NR4A1_HUMAN

NCBI Protein Information

nuclear receptor subfamily 4 group A member 1

NCBI Summary for NUR77

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

UniProt Comments for NUR77

Nur77: an orphan nuclear receptor and immediate-early gene that regulates cellular proliferation, apoptosis, inflammation, and glucose metabolism. Induced by exercise in muscle and is a functional regulator of glucose metabolism in skeletal muscle. Its level decreases in the muscle of obese insulin-resistant men. Acts concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3'. May inhibit NF-kappa-B transactivation of IL2. A mediator of TCR-directed thymocyte apoptosis. TCR-signaling induces a FAIM/Akt/Nur77 signaling pathway that is critical for modulating apoptosis in developing thymocytes. A physiological substrate of the MEK-ERK-RSK cascade that modulates nuclear export and intracellular translocation during T cell death. Binds DNA as a monomer. Interacts with GADD45GIP1. Overexpression of Nur77 induces the expression of both p300 and HDAC1. Acetylation by p300 and HDAC1 may regulate the rapid turnover of Nur77 protein.

Protein type: Apoptosis; DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: cytoplasm; nuclear membrane; nucleoplasm; nucleus

Molecular Function: DNA binding; ligand-dependent nuclear receptor activity; protein binding; protein heterodimerization activity; sequence-specific DNA binding; steroid hormone receptor activity; zinc ion binding

Biological Process: cell migration during sprouting angiogenesis; fat cell differentiation; intracellular receptor-mediated signaling pathway; negative regulation of cell cycle; positive regulation of endothelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; signal transduction; steroid hormone mediated signaling; transcription initiation from RNA polymerase II promoter

Research Articles on NUR77

1. Molecular dynamics simulation results of NR4A1 reveal a pronounced pocket that binds the known ligands which is similar to known nucleotide-binding sites. Its molecular conformation can be affected by alternate-site modulators.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-NUR77 antibody

Reference Product	PubMed Publications
POMC antibody	>43 publications with NUR77 and POMC
MEF2D antibody	>8 publications with NUR77 and MEF2D
BCL2 antibody	>7 publications with NUR77 and BCL2
NCOR2 antibody	>4 publications with NUR77 and NCOR2
EP300 antibody	>4 publications with NUR77 and EP300
AKT1 antibody	>4 publications with NUR77 and AKT1
NR0B2 antibody	>2 publications with NUR77 and NR0B2
MAPK8 antibody	>1 publications with NUR77 and MAPK8
MED1 antibody	>1 publications with NUR77 and MED1

Pathways associated with anti-NUR77 antibody

Products by Pathway	Pathway Diagram
AKT Phosphorylates Targets In The Nucleus Pathway antibodies	AKT Phosphorylates Targets In The Nucleus Pathway Diagram
Adaptive Immune System Pathway antibodies	Adaptive Immune System Pathway Diagram
Aldosterone Synthesis And Secretion Pathway antibodies	Aldosterone Synthesis And Secretion Pathway Diagram
Aldosterone Synthesis And Secretion Pathway antibodies	Aldosterone Synthesis And Secretion Pathway Diagram
Constitutive Signaling By AKT1 E17K In Cancer Pathway antibodies	Constitutive Signaling By AKT1 E17K In Cancer Pathway Diagram
Corticotropin-releasing Hormone Pathway antibodies	Corticotropin-releasing Hormone Pathway Diagram
DAP12 Interactions Pathway antibodies	DAP12 Interactions Pathway Diagram
DAP12 Signaling Pathway antibodies	DAP12 Signaling Pathway Diagram
Disease Pathway antibodies	Disease Pathway Diagram
Diseases Of Signal Transduction Pathway antibodies	Diseases Of Signal Transduction Pathway Diagram

Diseases associated with anti-NUR77 antibody

Disease Name	Pubmed Publications
Inflammation Antibodies	>85 publications with NUR77 and Inflammation
Cardiovascular Diseases Antibodies	>72 publications with NUR77 and Cardiovascular Diseases
Nervous System Diseases Antibodies	>60 publications with NUR77 and Nervous System Diseases
Brain Diseases Antibodies	>50 publications with NUR77 and Brain Diseases
Disease Models, Animal Antibodies	>46 publications with NUR77 and Disease Models, Animal
Necrosis Antibodies	>40 publications with NUR77 and Necrosis
Atherosclerosis Antibodies	>34 publications with NUR77 and Atherosclerosis
Lung Diseases Antibodies	>22 publications with NUR77 and Lung Diseases
Liver Diseases Antibodies	>22 publications with NUR77 and Liver Diseases
Lung Neoplasms Antibodies	>20 publications with NUR77 and Lung Neoplasms

Organs/Tissues associated with anti-NUR77 antibody

Organ/Tissue Name	Pubmed Publications
Brain Antibodies	>204 publications with NUR77 and Brain
Blood Antibodies	>198 publications with NUR77 and Blood
Nerve Antibodies	>177 publications with NUR77 and Nerve
Thyroid Antibodies	>130 publications with NUR77 and Thyroid
Muscle Antibodies	>90 publications with NUR77 and Muscle
Liver Antibodies	>59 publications with NUR77 and Liver
Thymus Antibodies	>46 publications with NUR77 and Thymus
Adrenal Gland Antibodies	>41 publications with NUR77 and Adrenal Gland
Lung Antibodies	>39 publications with NUR77 and Lung
Testis Antibodies	>37 publications with NUR77 and Testis